Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1PBT1

Protein Details
Accession A0A4Z1PBT1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
74-99QSLTSNRPSRKTRNRTELRARGQNKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MYHPFQENIFTLLNFNPDPTNDNSILESVYAEYSHFLTTPQTISKTIPPTQPTSSISISKNKNIPFPPQPPQLQSLTSNRPSRKTRNRTELRARGQNKTSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.15
4 0.15
5 0.18
6 0.2
7 0.25
8 0.22
9 0.23
10 0.22
11 0.22
12 0.21
13 0.17
14 0.13
15 0.08
16 0.08
17 0.07
18 0.06
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.08
26 0.1
27 0.11
28 0.12
29 0.12
30 0.14
31 0.18
32 0.22
33 0.24
34 0.26
35 0.27
36 0.29
37 0.29
38 0.31
39 0.28
40 0.27
41 0.26
42 0.26
43 0.26
44 0.29
45 0.3
46 0.31
47 0.35
48 0.32
49 0.36
50 0.34
51 0.39
52 0.39
53 0.43
54 0.46
55 0.47
56 0.49
57 0.45
58 0.47
59 0.42
60 0.37
61 0.35
62 0.35
63 0.36
64 0.41
65 0.46
66 0.46
67 0.51
68 0.56
69 0.62
70 0.67
71 0.69
72 0.72
73 0.76
74 0.82
75 0.84
76 0.89
77 0.88
78 0.86
79 0.86
80 0.8
81 0.77