Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1P7Q7

Protein Details
Accession A0A4Z1P7Q7   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
62-86QNTDKGKSNAGKKKKNKKGKRGGKRBasic
NLS Segment(s)
PositionSequence
67-86GKSNAGKKKKNKKGKRGGKR
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MSDRSTSPVGRREKTAQRPSAYSGGHFFEIHIGDVYQGHYIVFDKLGYGSKFILSIHRYHLQNTDKGKSNAGKKKKNKKGKRGGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.68
3 0.67
4 0.63
5 0.63
6 0.62
7 0.6
8 0.5
9 0.41
10 0.34
11 0.29
12 0.27
13 0.24
14 0.19
15 0.16
16 0.16
17 0.15
18 0.12
19 0.1
20 0.08
21 0.09
22 0.1
23 0.07
24 0.06
25 0.06
26 0.05
27 0.06
28 0.06
29 0.06
30 0.05
31 0.05
32 0.06
33 0.09
34 0.09
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1
40 0.15
41 0.13
42 0.15
43 0.19
44 0.25
45 0.25
46 0.27
47 0.34
48 0.33
49 0.37
50 0.41
51 0.41
52 0.42
53 0.43
54 0.47
55 0.45
56 0.52
57 0.55
58 0.61
59 0.66
60 0.69
61 0.79
62 0.85
63 0.9
64 0.9
65 0.92
66 0.93