Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1NJ53

Protein Details
Accession A0A4Z1NJ53    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-37VALSRFRFKRHRRGGECSCFLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 6.5, cyto_nucl 6, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002772  Glyco_hydro_3_C  
IPR036881  Glyco_hydro_3_C_sf  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF01915  Glyco_hydro_3_C  
Amino Acid Sequences MSTLYFSKRLQPKTLTVALSRFRFKRHRRGGECSCFLQQYCYRHPRHGPTLLPFTDHPHVTAVLLGHYPGQELGNALVDILYGDINPSGKLPYTIAYDELEYNGAPITAVNVTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.5
3 0.44
4 0.45
5 0.45
6 0.45
7 0.46
8 0.4
9 0.42
10 0.49
11 0.55
12 0.6
13 0.65
14 0.71
15 0.71
16 0.79
17 0.82
18 0.81
19 0.77
20 0.69
21 0.6
22 0.5
23 0.44
24 0.4
25 0.34
26 0.3
27 0.35
28 0.4
29 0.4
30 0.43
31 0.48
32 0.49
33 0.51
34 0.51
35 0.45
36 0.41
37 0.45
38 0.41
39 0.38
40 0.31
41 0.29
42 0.27
43 0.24
44 0.2
45 0.15
46 0.15
47 0.13
48 0.13
49 0.09
50 0.07
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.05
59 0.06
60 0.06
61 0.07
62 0.07
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.04
69 0.03
70 0.03
71 0.04
72 0.05
73 0.05
74 0.06
75 0.07
76 0.07
77 0.09
78 0.09
79 0.11
80 0.15
81 0.16
82 0.17
83 0.17
84 0.18
85 0.17
86 0.17
87 0.16
88 0.11
89 0.11
90 0.09
91 0.08
92 0.07
93 0.06
94 0.08