Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1NX45

Protein Details
Accession A0A4Z1NX45    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
39-65TQSKTQQALKREKKCRQKQVSNYVRIYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 5.5, cyto_mito 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSVLESKAMEDARARALQVAAEAAEIAAEEDAQSLRRETQSKTQQALKREKKCRQKQVSNYVRIYPFKVPGDRIWRFWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.17
4 0.16
5 0.14
6 0.13
7 0.08
8 0.07
9 0.07
10 0.05
11 0.04
12 0.04
13 0.04
14 0.03
15 0.03
16 0.03
17 0.03
18 0.04
19 0.05
20 0.06
21 0.06
22 0.08
23 0.11
24 0.13
25 0.15
26 0.24
27 0.31
28 0.35
29 0.37
30 0.44
31 0.45
32 0.5
33 0.59
34 0.6
35 0.61
36 0.67
37 0.73
38 0.76
39 0.83
40 0.86
41 0.86
42 0.86
43 0.86
44 0.88
45 0.89
46 0.86
47 0.78
48 0.73
49 0.68
50 0.6
51 0.54
52 0.47
53 0.43
54 0.4
55 0.42
56 0.39
57 0.42
58 0.5
59 0.49