Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1ND57

Protein Details
Accession A0A4Z1ND57    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
23-49EIEAEKAAPPRKRQRTPSKVEQPSNSAHydrophilic
NLS Segment(s)
PositionSequence
18-37KRRLSEIEAEKAAPPRKRQR
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037651  Swc3  
Gene Ontology GO:0000812  C:Swr1 complex  
GO:0140849  F:ATP-dependent H2AZ histone chaperone activity  
Amino Acid Sequences MVAERRQSSRIKAELPEKRRLSEIEAEKAAPPRKRQRTPSKVEQPSNSAGTLPTKVADGRPLPTLKTPQPSDLLDTEYQSVLDSGVLLASFTRSRQIWTHGTLLEKFWSKTKAPSAKKIKEMTEEEKAAHKAAKGPAMSKIGSATITIEPHAFEVTLFVVKDTTPGIKQGQLPPERQFQQYHAPQPSLAPAYRPPQQQYHPPTLAHTVQYQTPSQPPRPVPAPPVRPPQNVPSAPAPAAPRSQGSNAIPSPAPAPVAAPPKPNPGPDPVIKALAARAATDPELKKVMKVVAQGNASSSELEYFQQHIKELTEQFEKERDEKEKWKPHSTVKPPVPAAPRPPVQNNTAYPVNGMAPRPPNIPYTHPNPQPPRPRIVSTPAPLQILIQFGENANDRYSIPKNSILEFLPGNSLLCSFVVVKTGAEAVDKNGLDLKLEYWQPVTMKISAESHILDMIGRVVATADESRAYMGRVIERCKRADELNLAFRLPKVSAEGEGSLMSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.68
4 0.63
5 0.59
6 0.58
7 0.53
8 0.5
9 0.49
10 0.5
11 0.47
12 0.46
13 0.45
14 0.45
15 0.5
16 0.51
17 0.47
18 0.5
19 0.54
20 0.62
21 0.7
22 0.78
23 0.81
24 0.85
25 0.88
26 0.9
27 0.9
28 0.89
29 0.87
30 0.81
31 0.76
32 0.7
33 0.64
34 0.53
35 0.42
36 0.34
37 0.3
38 0.28
39 0.22
40 0.17
41 0.16
42 0.17
43 0.18
44 0.23
45 0.22
46 0.22
47 0.28
48 0.29
49 0.3
50 0.34
51 0.4
52 0.39
53 0.45
54 0.45
55 0.42
56 0.45
57 0.44
58 0.44
59 0.38
60 0.37
61 0.29
62 0.28
63 0.26
64 0.22
65 0.21
66 0.16
67 0.15
68 0.1
69 0.08
70 0.07
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.07
77 0.08
78 0.08
79 0.12
80 0.12
81 0.16
82 0.19
83 0.25
84 0.27
85 0.3
86 0.34
87 0.32
88 0.35
89 0.33
90 0.32
91 0.31
92 0.29
93 0.26
94 0.26
95 0.29
96 0.27
97 0.32
98 0.4
99 0.45
100 0.48
101 0.57
102 0.64
103 0.66
104 0.73
105 0.72
106 0.66
107 0.64
108 0.64
109 0.6
110 0.56
111 0.51
112 0.44
113 0.44
114 0.41
115 0.34
116 0.3
117 0.25
118 0.23
119 0.25
120 0.29
121 0.25
122 0.26
123 0.3
124 0.31
125 0.31
126 0.25
127 0.22
128 0.18
129 0.17
130 0.16
131 0.13
132 0.12
133 0.12
134 0.12
135 0.12
136 0.11
137 0.11
138 0.11
139 0.09
140 0.06
141 0.07
142 0.07
143 0.09
144 0.08
145 0.08
146 0.08
147 0.08
148 0.09
149 0.09
150 0.1
151 0.09
152 0.12
153 0.13
154 0.16
155 0.2
156 0.25
157 0.33
158 0.35
159 0.37
160 0.38
161 0.44
162 0.43
163 0.42
164 0.38
165 0.33
166 0.38
167 0.4
168 0.44
169 0.4
170 0.37
171 0.35
172 0.34
173 0.34
174 0.27
175 0.22
176 0.16
177 0.17
178 0.21
179 0.26
180 0.29
181 0.28
182 0.31
183 0.33
184 0.4
185 0.43
186 0.47
187 0.44
188 0.41
189 0.4
190 0.39
191 0.38
192 0.3
193 0.26
194 0.19
195 0.18
196 0.2
197 0.19
198 0.16
199 0.21
200 0.24
201 0.25
202 0.3
203 0.29
204 0.31
205 0.33
206 0.33
207 0.34
208 0.37
209 0.42
210 0.41
211 0.5
212 0.51
213 0.51
214 0.51
215 0.49
216 0.5
217 0.43
218 0.4
219 0.33
220 0.3
221 0.28
222 0.28
223 0.25
224 0.18
225 0.18
226 0.16
227 0.15
228 0.14
229 0.15
230 0.16
231 0.16
232 0.19
233 0.18
234 0.19
235 0.18
236 0.16
237 0.16
238 0.12
239 0.12
240 0.07
241 0.08
242 0.1
243 0.15
244 0.16
245 0.19
246 0.2
247 0.26
248 0.28
249 0.28
250 0.26
251 0.25
252 0.28
253 0.27
254 0.31
255 0.25
256 0.25
257 0.24
258 0.22
259 0.18
260 0.16
261 0.14
262 0.1
263 0.09
264 0.09
265 0.09
266 0.14
267 0.14
268 0.13
269 0.17
270 0.16
271 0.16
272 0.17
273 0.18
274 0.16
275 0.19
276 0.2
277 0.21
278 0.22
279 0.22
280 0.21
281 0.2
282 0.18
283 0.15
284 0.12
285 0.08
286 0.08
287 0.08
288 0.08
289 0.09
290 0.11
291 0.12
292 0.12
293 0.12
294 0.13
295 0.16
296 0.17
297 0.18
298 0.2
299 0.2
300 0.21
301 0.25
302 0.26
303 0.24
304 0.27
305 0.28
306 0.29
307 0.37
308 0.45
309 0.5
310 0.54
311 0.59
312 0.59
313 0.63
314 0.69
315 0.68
316 0.69
317 0.65
318 0.66
319 0.6
320 0.62
321 0.58
322 0.52
323 0.5
324 0.46
325 0.44
326 0.41
327 0.45
328 0.42
329 0.4
330 0.42
331 0.38
332 0.36
333 0.35
334 0.31
335 0.26
336 0.23
337 0.22
338 0.19
339 0.18
340 0.18
341 0.19
342 0.21
343 0.22
344 0.23
345 0.24
346 0.24
347 0.29
348 0.29
349 0.33
350 0.41
351 0.44
352 0.51
353 0.55
354 0.61
355 0.66
356 0.65
357 0.65
358 0.61
359 0.6
360 0.55
361 0.55
362 0.54
363 0.47
364 0.5
365 0.45
366 0.41
367 0.37
368 0.34
369 0.28
370 0.21
371 0.18
372 0.13
373 0.11
374 0.1
375 0.13
376 0.14
377 0.14
378 0.13
379 0.14
380 0.14
381 0.18
382 0.22
383 0.21
384 0.23
385 0.27
386 0.28
387 0.29
388 0.31
389 0.27
390 0.26
391 0.24
392 0.22
393 0.18
394 0.17
395 0.16
396 0.13
397 0.12
398 0.1
399 0.1
400 0.11
401 0.09
402 0.09
403 0.11
404 0.12
405 0.11
406 0.11
407 0.12
408 0.11
409 0.11
410 0.11
411 0.11
412 0.17
413 0.17
414 0.17
415 0.2
416 0.2
417 0.2
418 0.2
419 0.19
420 0.18
421 0.19
422 0.2
423 0.17
424 0.2
425 0.19
426 0.22
427 0.24
428 0.21
429 0.21
430 0.23
431 0.24
432 0.22
433 0.24
434 0.21
435 0.18
436 0.16
437 0.15
438 0.12
439 0.1
440 0.1
441 0.08
442 0.07
443 0.06
444 0.06
445 0.06
446 0.09
447 0.09
448 0.09
449 0.1
450 0.1
451 0.12
452 0.12
453 0.13
454 0.13
455 0.15
456 0.22
457 0.26
458 0.32
459 0.4
460 0.44
461 0.46
462 0.47
463 0.48
464 0.43
465 0.46
466 0.48
467 0.47
468 0.5
469 0.49
470 0.46
471 0.43
472 0.41
473 0.37
474 0.29
475 0.23
476 0.19
477 0.19
478 0.21
479 0.23
480 0.23
481 0.21