Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1P2R7

Protein Details
Accession A0A4Z1P2R7   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-45CLSVIDLRPHRRKDKSRAPGNMFPPTHydrophilic
NLS Segment(s)
PositionSequence
400-404RKRKG
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSLVDKSNADPNKPPGYDDCLSVIDLRPHRRKDKSRAPGNMFPPTPSLPIQPENRHVEPPNMSPHFGPGAGPQMNPAYINMLKTPPVQVQPAMYQQSPLSPTAQDVEVIRRANILLDAVKNVWGDSSSEADSSDEEEAAAPTSESFDYVSTFEKTNAPINAAPIVLPSVEEQQTPNSPHAPICLAPPAAARPPRQGHIMQFDKNAGKLPTPPSEPSPTQIPSVPDPPPRQSPATSNPGIPRYLPSPYPVLASKPSKSRNFSLHPPHPTAFPPPTMGDFKPVNGHGAAYLSSNHTQQPYYFVPPTGDPKDQRYSQSSALPTNGPAVISLPPALPKTGTNGSAVPRIPSSQHQAPTIPPKNGTVVRLSDPGPAKEHPMWKPPKNGTLIDFGKTTKPFQSGSRKRKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.42
3 0.47
4 0.44
5 0.4
6 0.36
7 0.28
8 0.29
9 0.28
10 0.27
11 0.27
12 0.33
13 0.41
14 0.47
15 0.53
16 0.61
17 0.7
18 0.77
19 0.79
20 0.84
21 0.84
22 0.86
23 0.88
24 0.87
25 0.85
26 0.82
27 0.8
28 0.69
29 0.6
30 0.55
31 0.47
32 0.42
33 0.35
34 0.33
35 0.28
36 0.34
37 0.41
38 0.42
39 0.48
40 0.52
41 0.53
42 0.55
43 0.52
44 0.51
45 0.48
46 0.46
47 0.48
48 0.43
49 0.41
50 0.36
51 0.37
52 0.33
53 0.29
54 0.25
55 0.17
56 0.23
57 0.23
58 0.22
59 0.21
60 0.21
61 0.21
62 0.2
63 0.18
64 0.16
65 0.16
66 0.17
67 0.17
68 0.17
69 0.19
70 0.2
71 0.22
72 0.21
73 0.23
74 0.23
75 0.22
76 0.24
77 0.25
78 0.3
79 0.3
80 0.26
81 0.25
82 0.23
83 0.26
84 0.25
85 0.23
86 0.18
87 0.15
88 0.16
89 0.16
90 0.17
91 0.14
92 0.13
93 0.16
94 0.2
95 0.2
96 0.19
97 0.18
98 0.17
99 0.17
100 0.16
101 0.13
102 0.1
103 0.1
104 0.11
105 0.11
106 0.13
107 0.13
108 0.12
109 0.11
110 0.09
111 0.09
112 0.09
113 0.12
114 0.1
115 0.11
116 0.11
117 0.11
118 0.11
119 0.12
120 0.11
121 0.08
122 0.07
123 0.07
124 0.07
125 0.08
126 0.07
127 0.05
128 0.05
129 0.07
130 0.06
131 0.06
132 0.07
133 0.06
134 0.07
135 0.09
136 0.11
137 0.11
138 0.11
139 0.12
140 0.14
141 0.15
142 0.19
143 0.18
144 0.19
145 0.18
146 0.18
147 0.18
148 0.16
149 0.14
150 0.1
151 0.1
152 0.07
153 0.07
154 0.06
155 0.09
156 0.1
157 0.1
158 0.1
159 0.12
160 0.16
161 0.17
162 0.18
163 0.15
164 0.16
165 0.15
166 0.16
167 0.15
168 0.12
169 0.12
170 0.14
171 0.12
172 0.12
173 0.12
174 0.13
175 0.16
176 0.2
177 0.2
178 0.23
179 0.25
180 0.26
181 0.29
182 0.29
183 0.27
184 0.31
185 0.34
186 0.29
187 0.28
188 0.29
189 0.27
190 0.25
191 0.25
192 0.18
193 0.14
194 0.16
195 0.19
196 0.2
197 0.22
198 0.23
199 0.23
200 0.28
201 0.28
202 0.26
203 0.27
204 0.25
205 0.23
206 0.24
207 0.23
208 0.2
209 0.24
210 0.25
211 0.27
212 0.29
213 0.31
214 0.33
215 0.34
216 0.34
217 0.31
218 0.33
219 0.34
220 0.37
221 0.35
222 0.33
223 0.33
224 0.33
225 0.32
226 0.27
227 0.23
228 0.18
229 0.2
230 0.18
231 0.16
232 0.17
233 0.17
234 0.18
235 0.17
236 0.17
237 0.21
238 0.24
239 0.25
240 0.31
241 0.38
242 0.41
243 0.45
244 0.47
245 0.48
246 0.49
247 0.54
248 0.57
249 0.57
250 0.56
251 0.57
252 0.53
253 0.48
254 0.44
255 0.42
256 0.35
257 0.28
258 0.26
259 0.22
260 0.25
261 0.27
262 0.26
263 0.25
264 0.23
265 0.23
266 0.24
267 0.24
268 0.22
269 0.18
270 0.18
271 0.13
272 0.13
273 0.13
274 0.09
275 0.1
276 0.11
277 0.13
278 0.14
279 0.15
280 0.16
281 0.16
282 0.15
283 0.21
284 0.21
285 0.25
286 0.25
287 0.24
288 0.25
289 0.27
290 0.34
291 0.33
292 0.35
293 0.31
294 0.36
295 0.42
296 0.43
297 0.45
298 0.43
299 0.43
300 0.4
301 0.44
302 0.41
303 0.36
304 0.35
305 0.32
306 0.27
307 0.26
308 0.23
309 0.16
310 0.14
311 0.13
312 0.12
313 0.12
314 0.12
315 0.1
316 0.12
317 0.13
318 0.14
319 0.13
320 0.13
321 0.18
322 0.21
323 0.22
324 0.22
325 0.23
326 0.25
327 0.3
328 0.3
329 0.26
330 0.23
331 0.23
332 0.24
333 0.26
334 0.32
335 0.33
336 0.36
337 0.37
338 0.37
339 0.41
340 0.5
341 0.52
342 0.47
343 0.41
344 0.4
345 0.44
346 0.46
347 0.42
348 0.37
349 0.34
350 0.34
351 0.36
352 0.35
353 0.35
354 0.36
355 0.36
356 0.35
357 0.32
358 0.35
359 0.38
360 0.45
361 0.43
362 0.49
363 0.56
364 0.59
365 0.68
366 0.68
367 0.7
368 0.67
369 0.65
370 0.58
371 0.58
372 0.54
373 0.47
374 0.42
375 0.36
376 0.37
377 0.36
378 0.36
379 0.32
380 0.33
381 0.32
382 0.39
383 0.49
384 0.53