Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1PW40

Protein Details
Accession A0A4Z1PW40    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-61GAYIINEHKKHKKEKARVQEEQANIQPSRPRSSRRGSNSPKRQNPYREDRHydrophilic
NLS Segment(s)
PositionSequence
20-28KKHKKEKAR
41-46PRSSRR
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MVLLAGLELLAGAYIINEHKKHKKEKARVQEEQANIQPSRPRSSRRGSNSPKRQNPYREDRGYRSQSPNRYECFAKRHPHYDEPSSAKPTAAIVPPSYYHPPPLKAPVSPILAYQRPSSTPPATFAPPPTTHSPQAVARPLPPVSPVSPISPMESENQSHAPFDISDGFSPEQRQHQPMYANKCASVQYPDHLAELGDPSLTGKHEPQFQYDDGLIYDERRNRHVRFAIPRNGDETQLEIVHPRNVPPPPYTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.07
3 0.13
4 0.16
5 0.23
6 0.32
7 0.41
8 0.51
9 0.6
10 0.68
11 0.73
12 0.82
13 0.86
14 0.87
15 0.86
16 0.85
17 0.82
18 0.74
19 0.7
20 0.64
21 0.58
22 0.48
23 0.44
24 0.41
25 0.37
26 0.42
27 0.4
28 0.41
29 0.43
30 0.52
31 0.59
32 0.62
33 0.7
34 0.73
35 0.79
36 0.84
37 0.87
38 0.87
39 0.85
40 0.85
41 0.83
42 0.81
43 0.8
44 0.79
45 0.77
46 0.73
47 0.72
48 0.73
49 0.71
50 0.69
51 0.68
52 0.65
53 0.65
54 0.66
55 0.65
56 0.58
57 0.54
58 0.51
59 0.46
60 0.47
61 0.47
62 0.48
63 0.48
64 0.52
65 0.55
66 0.59
67 0.59
68 0.56
69 0.55
70 0.53
71 0.52
72 0.49
73 0.44
74 0.36
75 0.31
76 0.28
77 0.24
78 0.2
79 0.17
80 0.13
81 0.15
82 0.15
83 0.19
84 0.21
85 0.18
86 0.21
87 0.22
88 0.24
89 0.24
90 0.3
91 0.28
92 0.24
93 0.27
94 0.27
95 0.27
96 0.25
97 0.25
98 0.23
99 0.23
100 0.24
101 0.22
102 0.19
103 0.17
104 0.19
105 0.22
106 0.2
107 0.18
108 0.19
109 0.21
110 0.21
111 0.21
112 0.2
113 0.2
114 0.19
115 0.22
116 0.25
117 0.27
118 0.26
119 0.26
120 0.27
121 0.24
122 0.27
123 0.27
124 0.22
125 0.19
126 0.21
127 0.21
128 0.19
129 0.18
130 0.16
131 0.13
132 0.16
133 0.17
134 0.15
135 0.17
136 0.18
137 0.18
138 0.17
139 0.17
140 0.16
141 0.17
142 0.16
143 0.16
144 0.18
145 0.16
146 0.15
147 0.15
148 0.13
149 0.11
150 0.12
151 0.13
152 0.11
153 0.11
154 0.14
155 0.15
156 0.15
157 0.17
158 0.17
159 0.21
160 0.23
161 0.25
162 0.23
163 0.27
164 0.32
165 0.37
166 0.43
167 0.43
168 0.4
169 0.38
170 0.38
171 0.35
172 0.3
173 0.29
174 0.22
175 0.18
176 0.21
177 0.21
178 0.2
179 0.19
180 0.17
181 0.14
182 0.14
183 0.13
184 0.08
185 0.07
186 0.08
187 0.09
188 0.1
189 0.11
190 0.12
191 0.15
192 0.23
193 0.25
194 0.28
195 0.31
196 0.31
197 0.32
198 0.3
199 0.27
200 0.2
201 0.21
202 0.17
203 0.15
204 0.2
205 0.21
206 0.23
207 0.28
208 0.35
209 0.34
210 0.43
211 0.46
212 0.5
213 0.56
214 0.63
215 0.66
216 0.65
217 0.65
218 0.61
219 0.56
220 0.5
221 0.4
222 0.34
223 0.27
224 0.23
225 0.22
226 0.19
227 0.2
228 0.23
229 0.24
230 0.23
231 0.26
232 0.3
233 0.33