Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1NZ07

Protein Details
Accession A0A4Z1NZ07   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
99-126PAESKLTTEKYKKKQRHFPQRIYAVKVNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTSKVKAAQLWTKNKEDLRKQLDELKGELVQLRTQKIAGGNTSKLTKIHDVRKSIARVLTVINANQRAQLRIFYKNKKYMPLDLRPKQTRAIRRRLTPAESKLTTEKYKKKQRHFPQRIYAVKVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.63
3 0.64
4 0.63
5 0.64
6 0.61
7 0.6
8 0.57
9 0.59
10 0.59
11 0.52
12 0.46
13 0.39
14 0.32
15 0.28
16 0.28
17 0.21
18 0.2
19 0.2
20 0.2
21 0.18
22 0.17
23 0.18
24 0.18
25 0.19
26 0.19
27 0.2
28 0.2
29 0.21
30 0.23
31 0.22
32 0.19
33 0.2
34 0.24
35 0.26
36 0.33
37 0.37
38 0.39
39 0.41
40 0.47
41 0.46
42 0.41
43 0.37
44 0.28
45 0.23
46 0.21
47 0.21
48 0.15
49 0.14
50 0.14
51 0.15
52 0.14
53 0.17
54 0.17
55 0.15
56 0.14
57 0.18
58 0.18
59 0.25
60 0.33
61 0.37
62 0.44
63 0.51
64 0.52
65 0.54
66 0.55
67 0.54
68 0.55
69 0.57
70 0.6
71 0.58
72 0.66
73 0.63
74 0.62
75 0.61
76 0.61
77 0.61
78 0.59
79 0.64
80 0.61
81 0.63
82 0.7
83 0.68
84 0.67
85 0.65
86 0.62
87 0.6
88 0.54
89 0.52
90 0.48
91 0.48
92 0.49
93 0.51
94 0.54
95 0.57
96 0.66
97 0.72
98 0.78
99 0.83
100 0.87
101 0.9
102 0.91
103 0.9
104 0.9
105 0.91
106 0.87