Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1NTV4

Protein Details
Accession A0A4Z1NTV4    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPATGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
7-22GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 12, mito 10, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPATGGKKQKKKWSKGKVKDKANHAVVLDKATSDKLQKDVQSYRLITVAVLVDRLKINGSLARQALKDLEEAGTIKKVVGHSRMLVYTRDVAGGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.9
4 0.93
5 0.92
6 0.92
7 0.88
8 0.85
9 0.83
10 0.75
11 0.66
12 0.56
13 0.49
14 0.39
15 0.34
16 0.27
17 0.17
18 0.15
19 0.13
20 0.14
21 0.13
22 0.14
23 0.15
24 0.18
25 0.2
26 0.24
27 0.26
28 0.28
29 0.31
30 0.3
31 0.27
32 0.24
33 0.23
34 0.17
35 0.15
36 0.12
37 0.07
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.08
46 0.09
47 0.1
48 0.13
49 0.14
50 0.16
51 0.15
52 0.16
53 0.16
54 0.14
55 0.14
56 0.11
57 0.11
58 0.1
59 0.11
60 0.11
61 0.12
62 0.11
63 0.11
64 0.12
65 0.14
66 0.18
67 0.21
68 0.22
69 0.23
70 0.26
71 0.3
72 0.29
73 0.28
74 0.26
75 0.27
76 0.24