Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1PFB8

Protein Details
Accession A0A4Z1PFB8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
59-86VIIPRTRLYKRRKMKRWARKLGKVHEIVHydrophilic
89-111DMGYVRRQWKKQLKRTKAILLIRHydrophilic
NLS Segment(s)
PositionSequence
65-82RLYKRRKMKRWARKLGKV
98-102KKQLK
Subcellular Location(s) mito 14.5, mito_nucl 13.333, nucl 11, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MPTDSLNTSKPSKATPTTFLTLPREIRQCILSLTYRAPRVLKFDMSIMIARYDNPDPSVIIPRTRLYKRRKMKRWARKLGKVHEIVKEDMGYVRRQWKKQLKRTKAILLIRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.42
4 0.42
5 0.42
6 0.43
7 0.41
8 0.4
9 0.39
10 0.4
11 0.37
12 0.35
13 0.35
14 0.32
15 0.28
16 0.23
17 0.23
18 0.19
19 0.17
20 0.2
21 0.23
22 0.24
23 0.24
24 0.25
25 0.22
26 0.26
27 0.27
28 0.25
29 0.21
30 0.2
31 0.2
32 0.19
33 0.19
34 0.14
35 0.12
36 0.11
37 0.1
38 0.12
39 0.12
40 0.11
41 0.11
42 0.11
43 0.1
44 0.11
45 0.17
46 0.15
47 0.15
48 0.17
49 0.18
50 0.24
51 0.28
52 0.35
53 0.37
54 0.47
55 0.56
56 0.65
57 0.73
58 0.77
59 0.84
60 0.87
61 0.9
62 0.91
63 0.9
64 0.89
65 0.88
66 0.85
67 0.83
68 0.78
69 0.7
70 0.65
71 0.59
72 0.51
73 0.44
74 0.36
75 0.28
76 0.25
77 0.23
78 0.19
79 0.2
80 0.29
81 0.35
82 0.37
83 0.47
84 0.55
85 0.64
86 0.72
87 0.79
88 0.79
89 0.82
90 0.86
91 0.85
92 0.84