Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1P7T9

Protein Details
Accession A0A4Z1P7T9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
161-180REEREREVKREVKRKAKAKIBasic
NLS Segment(s)
PositionSequence
166-180REVKREVKRKAKAKI
Subcellular Location(s) mito 17.5, cyto_mito 11.833, cyto 5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024532  DUF3830  
Pfam View protein in Pfam  
PF12903  DUF3830  
Amino Acid Sequences MSSPPQNLIKITTPTHTFLARLETEAAPQTSALFLSHLPYTQKLIHVRWSGEALWIPLGYSNTINKVQNPNQTSLPQENHTAHPAPGQILLYPGGISETEFLWAYGACHFASKMGVLAGNHFLTVVEGGEGMRGLGEKVLWDGAVSVRFEVADEGMVELFREEREREVKREVKRKAKAKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.33
4 0.27
5 0.24
6 0.28
7 0.24
8 0.22
9 0.23
10 0.2
11 0.21
12 0.24
13 0.23
14 0.17
15 0.16
16 0.15
17 0.11
18 0.12
19 0.1
20 0.07
21 0.07
22 0.09
23 0.1
24 0.11
25 0.13
26 0.14
27 0.17
28 0.18
29 0.23
30 0.25
31 0.26
32 0.33
33 0.34
34 0.34
35 0.32
36 0.33
37 0.27
38 0.25
39 0.24
40 0.16
41 0.14
42 0.12
43 0.11
44 0.1
45 0.1
46 0.09
47 0.1
48 0.1
49 0.13
50 0.17
51 0.17
52 0.19
53 0.26
54 0.3
55 0.36
56 0.37
57 0.36
58 0.35
59 0.36
60 0.36
61 0.32
62 0.3
63 0.25
64 0.26
65 0.25
66 0.24
67 0.26
68 0.24
69 0.2
70 0.18
71 0.17
72 0.14
73 0.13
74 0.11
75 0.08
76 0.08
77 0.08
78 0.07
79 0.06
80 0.06
81 0.05
82 0.05
83 0.05
84 0.05
85 0.04
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.06
92 0.06
93 0.07
94 0.06
95 0.07
96 0.07
97 0.07
98 0.07
99 0.07
100 0.06
101 0.05
102 0.07
103 0.07
104 0.09
105 0.11
106 0.11
107 0.1
108 0.1
109 0.09
110 0.08
111 0.08
112 0.07
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.03
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.05
126 0.06
127 0.06
128 0.05
129 0.06
130 0.08
131 0.11
132 0.11
133 0.1
134 0.1
135 0.1
136 0.1
137 0.1
138 0.09
139 0.07
140 0.07
141 0.07
142 0.08
143 0.08
144 0.07
145 0.07
146 0.07
147 0.07
148 0.1
149 0.1
150 0.16
151 0.25
152 0.29
153 0.33
154 0.42
155 0.49
156 0.56
157 0.65
158 0.69
159 0.71
160 0.76