Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1PDG3

Protein Details
Accession A0A4Z1PDG3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
77-113ESIKLKKARGKGAPKKRRSAAESKRLQKRKPKGPTPTBasic
NLS Segment(s)
PositionSequence
80-110KLKKARGKGAPKKRRSAAESKRLQKRKPKGP
Subcellular Location(s) nucl 16, mito 10.5, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MAVARSRILDLIRTQCSVFNTTFNPERLRLGNKILRQRLKGPQMALYYPPRMRPIAELRKAYPELEFEDEKEEERLESIKLKKARGKGAPKKRRSAAESKRLQKRKPKGPTPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.31
4 0.31
5 0.27
6 0.23
7 0.22
8 0.26
9 0.3
10 0.3
11 0.31
12 0.28
13 0.31
14 0.31
15 0.34
16 0.31
17 0.34
18 0.37
19 0.39
20 0.47
21 0.52
22 0.54
23 0.53
24 0.56
25 0.56
26 0.57
27 0.55
28 0.47
29 0.44
30 0.41
31 0.39
32 0.37
33 0.32
34 0.3
35 0.28
36 0.28
37 0.25
38 0.23
39 0.23
40 0.24
41 0.3
42 0.35
43 0.39
44 0.39
45 0.37
46 0.42
47 0.42
48 0.38
49 0.29
50 0.2
51 0.18
52 0.2
53 0.19
54 0.15
55 0.18
56 0.18
57 0.18
58 0.17
59 0.14
60 0.1
61 0.11
62 0.11
63 0.09
64 0.15
65 0.17
66 0.24
67 0.27
68 0.33
69 0.37
70 0.42
71 0.5
72 0.53
73 0.61
74 0.64
75 0.72
76 0.78
77 0.8
78 0.83
79 0.81
80 0.8
81 0.76
82 0.76
83 0.75
84 0.75
85 0.78
86 0.78
87 0.83
88 0.83
89 0.84
90 0.83
91 0.83
92 0.83
93 0.84