Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1NJ01

Protein Details
Accession A0A4Z1NJ01    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-54FETGNVPHPYKKRRRRTASPGYTTTHydrophilic
NLS Segment(s)
PositionSequence
40-45KKRRRR
Subcellular Location(s) nucl 21, cyto 6
Family & Domain DBs
Amino Acid Sequences MSSCKWCGGELRHDDLGYVDSSTSERKRTFETGNVPHPYKKRRRRTASPGYTTTARAQSKGEVEYSATADMLYRRARSTQVLRPPFECTASGALRMRTQRVNSEKIKLKNVSNPCVCSIGDWEANLSLSQDFGSPKDISSHFASGVWSLLKVVQERAKREDDIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.36
3 0.32
4 0.23
5 0.17
6 0.11
7 0.09
8 0.1
9 0.16
10 0.18
11 0.23
12 0.24
13 0.25
14 0.31
15 0.35
16 0.38
17 0.39
18 0.45
19 0.46
20 0.53
21 0.56
22 0.53
23 0.54
24 0.57
25 0.6
26 0.62
27 0.66
28 0.68
29 0.73
30 0.81
31 0.85
32 0.88
33 0.89
34 0.89
35 0.85
36 0.77
37 0.7
38 0.62
39 0.55
40 0.47
41 0.44
42 0.34
43 0.28
44 0.26
45 0.24
46 0.25
47 0.24
48 0.21
49 0.14
50 0.14
51 0.14
52 0.14
53 0.11
54 0.09
55 0.07
56 0.07
57 0.07
58 0.1
59 0.11
60 0.11
61 0.11
62 0.13
63 0.14
64 0.18
65 0.23
66 0.26
67 0.34
68 0.38
69 0.38
70 0.38
71 0.41
72 0.37
73 0.33
74 0.26
75 0.19
76 0.18
77 0.17
78 0.19
79 0.16
80 0.16
81 0.19
82 0.2
83 0.21
84 0.2
85 0.21
86 0.26
87 0.3
88 0.36
89 0.35
90 0.42
91 0.47
92 0.47
93 0.53
94 0.48
95 0.46
96 0.47
97 0.51
98 0.51
99 0.47
100 0.46
101 0.41
102 0.4
103 0.36
104 0.29
105 0.26
106 0.22
107 0.2
108 0.18
109 0.17
110 0.15
111 0.15
112 0.14
113 0.12
114 0.08
115 0.07
116 0.07
117 0.08
118 0.08
119 0.09
120 0.13
121 0.13
122 0.13
123 0.18
124 0.19
125 0.21
126 0.25
127 0.26
128 0.22
129 0.22
130 0.23
131 0.18
132 0.19
133 0.16
134 0.11
135 0.1
136 0.12
137 0.14
138 0.15
139 0.2
140 0.26
141 0.31
142 0.36
143 0.42
144 0.44