Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1PH44

Protein Details
Accession A0A4Z1PH44    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
3-25LRYTVEQRIRQIRRNNQPIRPNLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 9.666, nucl 9, cyto_nucl 7.833, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLLRYTVEQRIRQIRRNNQPIRPNLTIDGKEVSRQSLAIGKGNRFNTAVEVQYSFSGTILAHTYKNNTFTFAAADPGFPHSLRADRGIVASKPVPVDEGNPPKPASPPKAGSQSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.8
4 0.81
5 0.79
6 0.81
7 0.8
8 0.78
9 0.7
10 0.62
11 0.55
12 0.53
13 0.46
14 0.39
15 0.35
16 0.27
17 0.27
18 0.25
19 0.23
20 0.17
21 0.16
22 0.15
23 0.16
24 0.17
25 0.2
26 0.22
27 0.23
28 0.28
29 0.29
30 0.29
31 0.25
32 0.24
33 0.22
34 0.2
35 0.19
36 0.14
37 0.14
38 0.13
39 0.13
40 0.13
41 0.09
42 0.08
43 0.07
44 0.06
45 0.06
46 0.07
47 0.08
48 0.08
49 0.09
50 0.12
51 0.13
52 0.17
53 0.16
54 0.17
55 0.17
56 0.16
57 0.18
58 0.16
59 0.17
60 0.13
61 0.13
62 0.11
63 0.13
64 0.14
65 0.12
66 0.13
67 0.11
68 0.14
69 0.15
70 0.18
71 0.16
72 0.16
73 0.18
74 0.2
75 0.19
76 0.2
77 0.2
78 0.19
79 0.18
80 0.18
81 0.18
82 0.14
83 0.18
84 0.23
85 0.32
86 0.34
87 0.36
88 0.37
89 0.36
90 0.41
91 0.46
92 0.43
93 0.41
94 0.43
95 0.47