Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1NNI2

Protein Details
Accession A0A4Z1NNI2    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-109AAEQAERGKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKKEERKSFFSIRIBasic
NLS Segment(s)
PositionSequence
9-102AKPTIKKAAEQAERGKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKKEERK
Subcellular Location(s) mito 14, nucl 12.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MSAMLLRPAKPTIKKAAEQAERGKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKNKKKEERKSFFSIRIPLDTLGSCKRIIDFRSSFSQILIGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.59
4 0.58
5 0.59
6 0.63
7 0.64
8 0.65
9 0.67
10 0.7
11 0.67
12 0.71
13 0.77
14 0.78
15 0.79
16 0.83
17 0.89
18 0.91
19 0.96
20 0.96
21 0.96
22 0.97
23 0.97
24 0.97
25 0.97
26 0.97
27 0.97
28 0.97
29 0.97
30 0.97
31 0.97
32 0.97
33 0.97
34 0.97
35 0.97
36 0.97
37 0.97
38 0.97
39 0.97
40 0.97
41 0.97
42 0.97
43 0.97
44 0.97
45 0.97
46 0.97
47 0.97
48 0.97
49 0.97
50 0.97
51 0.97
52 0.97
53 0.97
54 0.97
55 0.97
56 0.97
57 0.97
58 0.97
59 0.97
60 0.97
61 0.97
62 0.97
63 0.97
64 0.97
65 0.97
66 0.97
67 0.97
68 0.97
69 0.97
70 0.97
71 0.97
72 0.97
73 0.97
74 0.97
75 0.97
76 0.97
77 0.97
78 0.97
79 0.97
80 0.97
81 0.97
82 0.97
83 0.97
84 0.97
85 0.97
86 0.96
87 0.93
88 0.89
89 0.86
90 0.81
91 0.76
92 0.7
93 0.65
94 0.57
95 0.52
96 0.46
97 0.38
98 0.35
99 0.29
100 0.27
101 0.25
102 0.24
103 0.21
104 0.19
105 0.21
106 0.25
107 0.26
108 0.31
109 0.3
110 0.32
111 0.39
112 0.43
113 0.41
114 0.36