Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1P238

Protein Details
Accession A0A4Z1P238   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
53-79ETPFKVPKPAQTPKRRKKEPLITSDLPHydrophilic
331-351GKDIKKIKASKDKGKWKYMSEBasic
NLS Segment(s)
PositionSequence
62-70AQTPKRRKK
337-341IKASK
Subcellular Location(s) mito 21.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR003265  HhH-GPD_domain  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF00730  HhH-GPD  
CDD cd00056  ENDO3c  
Amino Acid Sequences MAERRSARVGARVSKGTATVINEAEGALQKQENKIAKPTSKTAVKRIASDSEETPFKVPKPAQTPKRRKKEPLITSDLPPSTPTPAAIAALSQGSTNPRRKPAGGVRKAATNITNAPLQTPEGTKVVKYPSDLFESALPSPNKAAEPGTTTENLLEKACAHLVSVDPKLQAVIDKHRCKMFSPEGLQEVVEPFTALSSGIMAQQVSGAAASSIKNKFNSLFTLPPNTGDGAKHFPTPAQVVEKDIATLRTAGLSQRKAEYIHGLAEKFVSGELSAQMLVEATDDEVMEKLIAVRGLGRWSVEMFACFGLKRTDIFSTGDLGVQRGMAAYVGKDIKKIKASKDKGKWKYMSEADMLKHSEKFSPYRSLFMWYMWRIEDVNLEAMES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.36
4 0.33
5 0.28
6 0.27
7 0.24
8 0.22
9 0.21
10 0.2
11 0.19
12 0.18
13 0.15
14 0.13
15 0.15
16 0.17
17 0.19
18 0.27
19 0.3
20 0.31
21 0.38
22 0.44
23 0.48
24 0.51
25 0.54
26 0.55
27 0.58
28 0.6
29 0.61
30 0.62
31 0.58
32 0.57
33 0.57
34 0.55
35 0.49
36 0.48
37 0.41
38 0.36
39 0.35
40 0.32
41 0.3
42 0.27
43 0.25
44 0.3
45 0.3
46 0.33
47 0.41
48 0.5
49 0.58
50 0.66
51 0.76
52 0.79
53 0.88
54 0.88
55 0.87
56 0.88
57 0.88
58 0.87
59 0.84
60 0.83
61 0.75
62 0.7
63 0.68
64 0.58
65 0.47
66 0.39
67 0.31
68 0.26
69 0.23
70 0.2
71 0.15
72 0.15
73 0.15
74 0.13
75 0.12
76 0.09
77 0.09
78 0.09
79 0.07
80 0.07
81 0.12
82 0.2
83 0.26
84 0.3
85 0.35
86 0.38
87 0.39
88 0.47
89 0.52
90 0.56
91 0.57
92 0.58
93 0.54
94 0.55
95 0.55
96 0.49
97 0.39
98 0.31
99 0.25
100 0.22
101 0.22
102 0.18
103 0.17
104 0.16
105 0.16
106 0.15
107 0.14
108 0.14
109 0.15
110 0.15
111 0.14
112 0.17
113 0.19
114 0.19
115 0.2
116 0.21
117 0.21
118 0.26
119 0.26
120 0.24
121 0.22
122 0.23
123 0.22
124 0.26
125 0.23
126 0.18
127 0.19
128 0.19
129 0.18
130 0.16
131 0.16
132 0.1
133 0.13
134 0.14
135 0.16
136 0.15
137 0.15
138 0.15
139 0.16
140 0.15
141 0.12
142 0.11
143 0.09
144 0.09
145 0.1
146 0.08
147 0.07
148 0.07
149 0.08
150 0.11
151 0.13
152 0.13
153 0.12
154 0.12
155 0.12
156 0.11
157 0.13
158 0.12
159 0.2
160 0.28
161 0.32
162 0.34
163 0.36
164 0.37
165 0.35
166 0.4
167 0.36
168 0.33
169 0.33
170 0.33
171 0.32
172 0.32
173 0.3
174 0.23
175 0.18
176 0.12
177 0.09
178 0.07
179 0.05
180 0.04
181 0.04
182 0.04
183 0.03
184 0.03
185 0.03
186 0.04
187 0.05
188 0.05
189 0.04
190 0.05
191 0.05
192 0.04
193 0.04
194 0.03
195 0.03
196 0.04
197 0.04
198 0.09
199 0.11
200 0.14
201 0.14
202 0.15
203 0.17
204 0.17
205 0.2
206 0.19
207 0.21
208 0.2
209 0.25
210 0.24
211 0.24
212 0.23
213 0.21
214 0.18
215 0.14
216 0.16
217 0.16
218 0.17
219 0.17
220 0.16
221 0.16
222 0.17
223 0.18
224 0.18
225 0.17
226 0.16
227 0.17
228 0.18
229 0.18
230 0.16
231 0.16
232 0.14
233 0.1
234 0.1
235 0.08
236 0.08
237 0.08
238 0.11
239 0.16
240 0.18
241 0.19
242 0.2
243 0.22
244 0.22
245 0.23
246 0.23
247 0.19
248 0.21
249 0.22
250 0.2
251 0.19
252 0.18
253 0.17
254 0.13
255 0.11
256 0.07
257 0.05
258 0.06
259 0.06
260 0.06
261 0.06
262 0.06
263 0.06
264 0.05
265 0.05
266 0.05
267 0.04
268 0.04
269 0.04
270 0.04
271 0.05
272 0.05
273 0.05
274 0.05
275 0.05
276 0.05
277 0.06
278 0.06
279 0.06
280 0.07
281 0.08
282 0.11
283 0.11
284 0.11
285 0.11
286 0.11
287 0.13
288 0.12
289 0.11
290 0.11
291 0.11
292 0.12
293 0.11
294 0.12
295 0.12
296 0.13
297 0.13
298 0.15
299 0.16
300 0.17
301 0.2
302 0.19
303 0.2
304 0.2
305 0.21
306 0.18
307 0.17
308 0.15
309 0.13
310 0.12
311 0.08
312 0.08
313 0.06
314 0.06
315 0.06
316 0.11
317 0.16
318 0.16
319 0.2
320 0.23
321 0.28
322 0.36
323 0.4
324 0.45
325 0.51
326 0.6
327 0.66
328 0.74
329 0.79
330 0.8
331 0.85
332 0.8
333 0.73
334 0.74
335 0.68
336 0.62
337 0.56
338 0.53
339 0.45
340 0.45
341 0.44
342 0.37
343 0.35
344 0.32
345 0.32
346 0.32
347 0.35
348 0.35
349 0.42
350 0.41
351 0.43
352 0.42
353 0.43
354 0.4
355 0.38
356 0.42
357 0.34
358 0.35
359 0.32
360 0.33
361 0.27
362 0.27
363 0.28
364 0.21
365 0.24