Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1NTA7

Protein Details
Accession A0A4Z1NTA7    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
36-60DSKPDVKQVNSNKRRKKTSSGATKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038871  C607.02c-like  
Amino Acid Sequences MPHKHKRVKTADGKDKEGQFNLPPTSLAKPLAAFADSKPDVKQVNSNKRRKKTSSGATKDDTPKAFLRLMEFKNSGKGRNGLDNGESKTATKKRKRTQVAEAEMTEEPKEAAAPALKILPGERLGDFAARVDQNMPIIGLARKGVKERQTKHEKKLQKMVNSWKENEAKRLEKAEDEWEAEEEKEQEEKEALEAKHGAIPVIQTRKGMKKGVDDDDDPWAILEARRERPKGLHDVAQAPPTFTNMPKETFKVRGGAKVNVTDVPNAAGSLKRREELGQTRADVIAQYRKMMALQRAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.75
3 0.7
4 0.61
5 0.53
6 0.47
7 0.47
8 0.43
9 0.36
10 0.3
11 0.28
12 0.29
13 0.29
14 0.26
15 0.21
16 0.19
17 0.2
18 0.21
19 0.19
20 0.16
21 0.14
22 0.22
23 0.22
24 0.23
25 0.22
26 0.25
27 0.26
28 0.27
29 0.35
30 0.36
31 0.46
32 0.55
33 0.65
34 0.7
35 0.77
36 0.84
37 0.82
38 0.8
39 0.79
40 0.79
41 0.8
42 0.78
43 0.76
44 0.7
45 0.72
46 0.68
47 0.64
48 0.55
49 0.47
50 0.42
51 0.39
52 0.37
53 0.3
54 0.3
55 0.32
56 0.33
57 0.36
58 0.36
59 0.33
60 0.39
61 0.4
62 0.38
63 0.33
64 0.35
65 0.31
66 0.36
67 0.38
68 0.31
69 0.32
70 0.34
71 0.32
72 0.3
73 0.28
74 0.21
75 0.28
76 0.33
77 0.4
78 0.44
79 0.52
80 0.59
81 0.69
82 0.77
83 0.75
84 0.78
85 0.78
86 0.76
87 0.7
88 0.61
89 0.54
90 0.46
91 0.41
92 0.3
93 0.2
94 0.13
95 0.09
96 0.09
97 0.05
98 0.06
99 0.07
100 0.07
101 0.07
102 0.08
103 0.08
104 0.08
105 0.08
106 0.09
107 0.09
108 0.1
109 0.1
110 0.1
111 0.11
112 0.11
113 0.1
114 0.09
115 0.1
116 0.09
117 0.09
118 0.09
119 0.09
120 0.09
121 0.09
122 0.08
123 0.05
124 0.07
125 0.06
126 0.06
127 0.07
128 0.08
129 0.09
130 0.11
131 0.15
132 0.22
133 0.3
134 0.33
135 0.42
136 0.52
137 0.57
138 0.6
139 0.65
140 0.64
141 0.61
142 0.66
143 0.62
144 0.56
145 0.57
146 0.62
147 0.63
148 0.6
149 0.56
150 0.53
151 0.54
152 0.49
153 0.48
154 0.43
155 0.36
156 0.35
157 0.37
158 0.32
159 0.26
160 0.27
161 0.25
162 0.22
163 0.2
164 0.19
165 0.16
166 0.16
167 0.15
168 0.14
169 0.11
170 0.1
171 0.1
172 0.09
173 0.09
174 0.09
175 0.09
176 0.1
177 0.16
178 0.15
179 0.15
180 0.16
181 0.16
182 0.18
183 0.18
184 0.16
185 0.1
186 0.11
187 0.15
188 0.19
189 0.19
190 0.19
191 0.23
192 0.3
193 0.34
194 0.36
195 0.33
196 0.36
197 0.41
198 0.45
199 0.45
200 0.4
201 0.38
202 0.38
203 0.36
204 0.28
205 0.22
206 0.16
207 0.13
208 0.12
209 0.17
210 0.19
211 0.27
212 0.34
213 0.35
214 0.37
215 0.4
216 0.45
217 0.47
218 0.44
219 0.42
220 0.39
221 0.43
222 0.43
223 0.45
224 0.39
225 0.32
226 0.28
227 0.25
228 0.24
229 0.2
230 0.25
231 0.23
232 0.27
233 0.29
234 0.32
235 0.33
236 0.37
237 0.37
238 0.36
239 0.35
240 0.39
241 0.4
242 0.42
243 0.41
244 0.4
245 0.4
246 0.37
247 0.37
248 0.3
249 0.26
250 0.22
251 0.19
252 0.16
253 0.15
254 0.15
255 0.17
256 0.24
257 0.27
258 0.26
259 0.27
260 0.29
261 0.37
262 0.42
263 0.44
264 0.42
265 0.41
266 0.42
267 0.4
268 0.39
269 0.31
270 0.27
271 0.3
272 0.25
273 0.25
274 0.24
275 0.24
276 0.26
277 0.31