Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1PN02

Protein Details
Accession A0A4Z1PN02    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
128-149VGREWGRKARVRQRKIVRKAMEBasic
NLS Segment(s)
PositionSequence
134-144RKARVRQRKIV
Subcellular Location(s) nucl 10, cyto 9.5, cyto_mito 6.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MAQEPINPMDKLMESSKYFYQEATTALSTWKENFTRNTSESFNQMTPKNWLRLVIIVCTYALIRPYILKLGAKVQQKHLEKEAKESDEKWAAMHPNDLRGGGGPKKKVDIPGVESEDEGEDGQGEVTVGREWGRKARVRQRKIVRKAMEIHEANLAKTGFESEDEDIADLLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.3
4 0.31
5 0.31
6 0.27
7 0.27
8 0.22
9 0.22
10 0.22
11 0.2
12 0.16
13 0.17
14 0.19
15 0.17
16 0.18
17 0.22
18 0.2
19 0.23
20 0.27
21 0.31
22 0.36
23 0.36
24 0.38
25 0.36
26 0.35
27 0.35
28 0.34
29 0.31
30 0.29
31 0.29
32 0.27
33 0.3
34 0.33
35 0.33
36 0.3
37 0.29
38 0.26
39 0.29
40 0.28
41 0.23
42 0.19
43 0.16
44 0.15
45 0.14
46 0.13
47 0.09
48 0.09
49 0.07
50 0.06
51 0.07
52 0.08
53 0.09
54 0.1
55 0.09
56 0.1
57 0.14
58 0.19
59 0.24
60 0.25
61 0.29
62 0.36
63 0.39
64 0.4
65 0.42
66 0.43
67 0.37
68 0.42
69 0.41
70 0.35
71 0.34
72 0.32
73 0.29
74 0.26
75 0.26
76 0.2
77 0.18
78 0.17
79 0.16
80 0.2
81 0.17
82 0.16
83 0.17
84 0.16
85 0.14
86 0.13
87 0.16
88 0.17
89 0.21
90 0.21
91 0.21
92 0.23
93 0.24
94 0.27
95 0.27
96 0.25
97 0.26
98 0.3
99 0.33
100 0.31
101 0.29
102 0.26
103 0.23
104 0.2
105 0.15
106 0.08
107 0.05
108 0.05
109 0.05
110 0.05
111 0.04
112 0.04
113 0.04
114 0.05
115 0.05
116 0.06
117 0.09
118 0.1
119 0.16
120 0.23
121 0.29
122 0.38
123 0.48
124 0.58
125 0.62
126 0.71
127 0.76
128 0.8
129 0.83
130 0.84
131 0.78
132 0.74
133 0.74
134 0.69
135 0.68
136 0.58
137 0.51
138 0.49
139 0.44
140 0.38
141 0.35
142 0.3
143 0.2
144 0.19
145 0.2
146 0.12
147 0.14
148 0.17
149 0.14
150 0.16
151 0.16
152 0.16