Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1NLZ6

Protein Details
Accession A0A4Z1NLZ6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
40-79AESKPTKPTKPTKPTKPTKPTKPTKPTKPTKPTKLTKPTKHydrophilic
NLS Segment(s)
PositionSequence
43-84KPTKPTKPTKPTKPTKPTKPTKPTKPTKPTKLTKPTKLTKKR
Subcellular Location(s) mito 15, nucl 7, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MSESTGFGTGTIRSATHQRLSGAVGTRCLTGPSTRDVGEAESKPTKPTKPTKPTKPTKPTKPTKPTKPTKPTKLTKPTKLTKKRAILPASDMDMSYQETDLLSHLSDCVLLGSAQGFILAIAAFIGLRTTTSHNVILGSRWNRDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.25
4 0.27
5 0.26
6 0.26
7 0.28
8 0.3
9 0.31
10 0.27
11 0.26
12 0.24
13 0.24
14 0.23
15 0.22
16 0.19
17 0.15
18 0.16
19 0.17
20 0.19
21 0.18
22 0.19
23 0.18
24 0.19
25 0.23
26 0.22
27 0.23
28 0.25
29 0.25
30 0.27
31 0.3
32 0.3
33 0.32
34 0.4
35 0.46
36 0.53
37 0.62
38 0.7
39 0.77
40 0.84
41 0.87
42 0.88
43 0.87
44 0.87
45 0.88
46 0.87
47 0.87
48 0.88
49 0.87
50 0.87
51 0.88
52 0.87
53 0.87
54 0.88
55 0.86
56 0.85
57 0.85
58 0.8
59 0.8
60 0.81
61 0.77
62 0.75
63 0.75
64 0.73
65 0.75
66 0.79
67 0.77
68 0.75
69 0.75
70 0.72
71 0.72
72 0.66
73 0.57
74 0.51
75 0.45
76 0.39
77 0.32
78 0.25
79 0.17
80 0.16
81 0.15
82 0.12
83 0.09
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.06
90 0.05
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.04
105 0.05
106 0.04
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.04
113 0.03
114 0.04
115 0.07
116 0.11
117 0.15
118 0.18
119 0.19
120 0.19
121 0.21
122 0.21
123 0.22
124 0.26
125 0.27