Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1P3S5

Protein Details
Accession A0A4Z1P3S5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
41-65APKQSKPQTPRPKRHTIPRKPLRAIHydrophilic
NLS Segment(s)
PositionSequence
31-74KKVQAPKKGDAPKQSKPQTPRPKRHTIPRKPLRAIRPNTPRKSP
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MGFLRRSKAPTEHPLNAFMAQIPRQASGSSKKVQAPKKGDAPKQSKPQTPRPKRHTIPRKPLRAIRPNTPRKSPVAAPKSTLITTPLKFANPPLRTGERHEYDQETSSWHIIAKADSCPVQPLPISFEMPGAFPQTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.47
4 0.39
5 0.31
6 0.27
7 0.21
8 0.23
9 0.21
10 0.19
11 0.19
12 0.19
13 0.21
14 0.24
15 0.28
16 0.28
17 0.32
18 0.36
19 0.43
20 0.5
21 0.55
22 0.55
23 0.55
24 0.61
25 0.65
26 0.65
27 0.67
28 0.67
29 0.66
30 0.7
31 0.7
32 0.67
33 0.64
34 0.7
35 0.72
36 0.75
37 0.77
38 0.75
39 0.79
40 0.77
41 0.82
42 0.82
43 0.81
44 0.82
45 0.8
46 0.81
47 0.75
48 0.77
49 0.75
50 0.74
51 0.67
52 0.65
53 0.67
54 0.68
55 0.67
56 0.64
57 0.57
58 0.51
59 0.51
60 0.46
61 0.45
62 0.42
63 0.39
64 0.37
65 0.37
66 0.36
67 0.32
68 0.28
69 0.22
70 0.2
71 0.2
72 0.2
73 0.19
74 0.18
75 0.18
76 0.21
77 0.28
78 0.24
79 0.26
80 0.29
81 0.32
82 0.34
83 0.4
84 0.45
85 0.39
86 0.41
87 0.42
88 0.39
89 0.37
90 0.37
91 0.31
92 0.25
93 0.23
94 0.2
95 0.18
96 0.15
97 0.14
98 0.13
99 0.15
100 0.14
101 0.14
102 0.16
103 0.17
104 0.17
105 0.2
106 0.19
107 0.19
108 0.18
109 0.18
110 0.21
111 0.23
112 0.24
113 0.21
114 0.22
115 0.2
116 0.2
117 0.21