Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1P616

Protein Details
Accession A0A4Z1P616    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
35-54RDSSPEPAVNRKKQRLQLLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, mito_nucl 10.833, nucl 9, cyto_nucl 8.333, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032054  Cdt1_C  
IPR038090  Cdt1_C_WH_dom_sf  
Gene Ontology GO:0007049  P:cell cycle  
Pfam View protein in Pfam  
PF16679  CDT1_C  
Amino Acid Sequences MARSQTYIHAFAKVSKPLGDGQATSNKRKHTRDIRDSSPEPAVNRKKQRLQLLTPPETPTKALKHAIANLSLSAIPLPALKVTKRKRAATLDIETPPTSPDPEDFEGIHHATDVPLEIEDLMNLNSAFLTALALQYAHHGSASPVDIRTLTPSVTKAWGKRKATVEDITLCLGVTASKNTKRNAFVLSNYGNGRVCVELGGKKQRKGFMYQGFNETEMRQQFELNLERAWKKWSAKGDTKAFIQDLPRAEIRKCSSLVKLEPTLAKGQQRLDQVLGPKESRHLKRRKVTFAEEPATVKKEEDVSVPAAEPVEVESATQKPATSATRGLDLLTRIQQKQHALSLLPTGPSQDQQNHTRALQRVEEILTILDLLAAGKGTGSRVSFPLPPLIQSIQASLRSPMEKEEVQRVLDIMVEEVAKGFVKIVGFGGVRACVVNRILRPRPEVLRERIEQAGKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.34
4 0.33
5 0.38
6 0.34
7 0.29
8 0.29
9 0.37
10 0.4
11 0.46
12 0.47
13 0.5
14 0.56
15 0.6
16 0.66
17 0.67
18 0.73
19 0.76
20 0.8
21 0.79
22 0.8
23 0.76
24 0.7
25 0.66
26 0.58
27 0.49
28 0.52
29 0.54
30 0.55
31 0.63
32 0.68
33 0.69
34 0.74
35 0.82
36 0.8
37 0.77
38 0.77
39 0.77
40 0.74
41 0.69
42 0.66
43 0.59
44 0.51
45 0.47
46 0.42
47 0.37
48 0.36
49 0.36
50 0.36
51 0.38
52 0.43
53 0.44
54 0.41
55 0.36
56 0.31
57 0.29
58 0.25
59 0.2
60 0.14
61 0.1
62 0.08
63 0.08
64 0.08
65 0.09
66 0.12
67 0.16
68 0.26
69 0.33
70 0.43
71 0.5
72 0.53
73 0.58
74 0.63
75 0.68
76 0.66
77 0.63
78 0.6
79 0.55
80 0.53
81 0.46
82 0.38
83 0.32
84 0.25
85 0.21
86 0.16
87 0.15
88 0.18
89 0.2
90 0.22
91 0.2
92 0.2
93 0.23
94 0.23
95 0.21
96 0.15
97 0.13
98 0.11
99 0.11
100 0.1
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.07
110 0.06
111 0.06
112 0.05
113 0.06
114 0.06
115 0.05
116 0.05
117 0.04
118 0.05
119 0.05
120 0.05
121 0.05
122 0.07
123 0.08
124 0.07
125 0.07
126 0.07
127 0.07
128 0.1
129 0.12
130 0.11
131 0.1
132 0.11
133 0.11
134 0.11
135 0.15
136 0.13
137 0.12
138 0.12
139 0.13
140 0.14
141 0.19
142 0.22
143 0.25
144 0.33
145 0.42
146 0.43
147 0.48
148 0.53
149 0.51
150 0.53
151 0.49
152 0.43
153 0.37
154 0.35
155 0.29
156 0.23
157 0.19
158 0.14
159 0.11
160 0.09
161 0.07
162 0.09
163 0.13
164 0.19
165 0.24
166 0.26
167 0.31
168 0.32
169 0.33
170 0.35
171 0.32
172 0.28
173 0.3
174 0.29
175 0.28
176 0.26
177 0.26
178 0.21
179 0.18
180 0.18
181 0.12
182 0.11
183 0.08
184 0.09
185 0.11
186 0.15
187 0.26
188 0.28
189 0.31
190 0.35
191 0.38
192 0.38
193 0.4
194 0.44
195 0.42
196 0.45
197 0.43
198 0.44
199 0.4
200 0.39
201 0.35
202 0.27
203 0.23
204 0.17
205 0.18
206 0.14
207 0.13
208 0.13
209 0.16
210 0.18
211 0.15
212 0.15
213 0.16
214 0.16
215 0.17
216 0.19
217 0.19
218 0.18
219 0.21
220 0.27
221 0.31
222 0.38
223 0.44
224 0.47
225 0.45
226 0.44
227 0.42
228 0.35
229 0.3
230 0.24
231 0.21
232 0.17
233 0.18
234 0.19
235 0.19
236 0.19
237 0.23
238 0.24
239 0.24
240 0.24
241 0.23
242 0.24
243 0.27
244 0.29
245 0.27
246 0.26
247 0.25
248 0.24
249 0.24
250 0.24
251 0.22
252 0.23
253 0.21
254 0.22
255 0.25
256 0.26
257 0.25
258 0.24
259 0.23
260 0.24
261 0.25
262 0.25
263 0.21
264 0.19
265 0.23
266 0.3
267 0.34
268 0.41
269 0.46
270 0.53
271 0.61
272 0.69
273 0.73
274 0.71
275 0.7
276 0.68
277 0.67
278 0.6
279 0.53
280 0.47
281 0.41
282 0.37
283 0.31
284 0.23
285 0.17
286 0.17
287 0.16
288 0.15
289 0.15
290 0.15
291 0.16
292 0.16
293 0.15
294 0.12
295 0.11
296 0.09
297 0.08
298 0.07
299 0.06
300 0.06
301 0.08
302 0.09
303 0.1
304 0.11
305 0.09
306 0.09
307 0.12
308 0.14
309 0.15
310 0.17
311 0.17
312 0.2
313 0.2
314 0.2
315 0.19
316 0.18
317 0.18
318 0.22
319 0.26
320 0.24
321 0.26
322 0.29
323 0.31
324 0.32
325 0.33
326 0.28
327 0.24
328 0.24
329 0.27
330 0.24
331 0.21
332 0.18
333 0.18
334 0.17
335 0.18
336 0.2
337 0.22
338 0.26
339 0.3
340 0.34
341 0.34
342 0.35
343 0.4
344 0.39
345 0.37
346 0.34
347 0.31
348 0.29
349 0.28
350 0.27
351 0.21
352 0.17
353 0.13
354 0.1
355 0.09
356 0.06
357 0.05
358 0.04
359 0.04
360 0.04
361 0.04
362 0.04
363 0.04
364 0.05
365 0.08
366 0.09
367 0.11
368 0.13
369 0.16
370 0.18
371 0.2
372 0.26
373 0.24
374 0.24
375 0.27
376 0.26
377 0.27
378 0.25
379 0.26
380 0.23
381 0.25
382 0.25
383 0.23
384 0.26
385 0.24
386 0.24
387 0.25
388 0.26
389 0.27
390 0.29
391 0.35
392 0.34
393 0.33
394 0.33
395 0.31
396 0.25
397 0.24
398 0.21
399 0.13
400 0.11
401 0.1
402 0.09
403 0.09
404 0.1
405 0.08
406 0.08
407 0.08
408 0.09
409 0.09
410 0.1
411 0.1
412 0.14
413 0.14
414 0.15
415 0.16
416 0.14
417 0.14
418 0.14
419 0.14
420 0.12
421 0.15
422 0.21
423 0.25
424 0.33
425 0.41
426 0.46
427 0.51
428 0.54
429 0.59
430 0.62
431 0.65
432 0.63
433 0.64
434 0.61
435 0.6
436 0.61