Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1NV71

Protein Details
Accession A0A4Z1NV71    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
50-74LIYEGKQKCRKDKPCKVVRNGCTKWHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, mito 2, plas 1, E.R. 1, golg 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MKFTIVTALFLVSGAIAGGPPVQHPKEWTQCGIEKNIHYCYKINPANAKLIYEGKQKCRKDKPCKVVRNGCTKWMQLVGKEWLADCSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.04
6 0.04
7 0.06
8 0.11
9 0.13
10 0.13
11 0.17
12 0.24
13 0.31
14 0.34
15 0.34
16 0.32
17 0.36
18 0.37
19 0.38
20 0.34
21 0.28
22 0.29
23 0.33
24 0.3
25 0.27
26 0.26
27 0.24
28 0.3
29 0.31
30 0.3
31 0.29
32 0.29
33 0.33
34 0.32
35 0.31
36 0.23
37 0.23
38 0.23
39 0.27
40 0.3
41 0.33
42 0.42
43 0.45
44 0.52
45 0.6
46 0.68
47 0.71
48 0.78
49 0.8
50 0.81
51 0.87
52 0.88
53 0.88
54 0.84
55 0.84
56 0.76
57 0.72
58 0.66
59 0.57
60 0.5
61 0.48
62 0.42
63 0.34
64 0.37
65 0.35
66 0.33
67 0.33
68 0.3