Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1NQ16

Protein Details
Accession A0A4Z1NQ16    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
78-108AEKLKKMKPFSPPKPQKKKEVKVQTPPPPKPBasic
NLS Segment(s)
PositionSequence
80-100KLKKMKPFSPPKPQKKKEVKV
Subcellular Location(s) nucl 20.5, cyto_nucl 14.333, mito_nucl 11.166, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR037830  ZZZ3  
Amino Acid Sequences MSPAENDNPSPKSSVPPSVPPSVPSSIPSSIPPATVQPVDYEVPKSQSIPPQVSPPPVRRPSYEQLVPAEVANAMGIAEKLKKMKPFSPPKPQKKKEVKVQTPPPPKPAVYIPRPPTEPFSDKSNPDGIALRSTASLLQMQAAKAKQDLQALEQLKALAVEDPVAFTQELVAGRVKTQANAGGILGPTLGPMESLFKDPASDEVKSEEDETIKDSTDATAEGDTTTTSAIPISNTASRFPQIPAPQNIVRVPPINWAKYGVVGDALDRLHEEQRTNPTPNQPEILPTRDAQPAQPVLEQHQDSAEKAPVYQMAAPYNPLKDTPQSAVGRGFKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.44
4 0.48
5 0.52
6 0.51
7 0.47
8 0.47
9 0.42
10 0.39
11 0.32
12 0.32
13 0.27
14 0.28
15 0.27
16 0.27
17 0.25
18 0.25
19 0.24
20 0.21
21 0.23
22 0.23
23 0.22
24 0.18
25 0.21
26 0.21
27 0.21
28 0.22
29 0.2
30 0.23
31 0.24
32 0.24
33 0.26
34 0.31
35 0.36
36 0.37
37 0.36
38 0.4
39 0.43
40 0.48
41 0.49
42 0.49
43 0.53
44 0.56
45 0.57
46 0.55
47 0.59
48 0.58
49 0.61
50 0.57
51 0.5
52 0.46
53 0.45
54 0.41
55 0.33
56 0.26
57 0.17
58 0.14
59 0.1
60 0.07
61 0.05
62 0.05
63 0.05
64 0.05
65 0.07
66 0.09
67 0.13
68 0.17
69 0.22
70 0.26
71 0.32
72 0.41
73 0.5
74 0.57
75 0.65
76 0.73
77 0.79
78 0.86
79 0.85
80 0.86
81 0.86
82 0.86
83 0.85
84 0.86
85 0.83
86 0.82
87 0.86
88 0.86
89 0.85
90 0.79
91 0.73
92 0.66
93 0.57
94 0.49
95 0.48
96 0.46
97 0.42
98 0.48
99 0.48
100 0.48
101 0.51
102 0.49
103 0.46
104 0.44
105 0.41
106 0.33
107 0.37
108 0.36
109 0.35
110 0.37
111 0.35
112 0.29
113 0.27
114 0.27
115 0.2
116 0.18
117 0.17
118 0.15
119 0.12
120 0.12
121 0.11
122 0.09
123 0.09
124 0.07
125 0.08
126 0.09
127 0.09
128 0.13
129 0.13
130 0.12
131 0.12
132 0.14
133 0.15
134 0.16
135 0.16
136 0.15
137 0.21
138 0.22
139 0.22
140 0.2
141 0.17
142 0.15
143 0.14
144 0.13
145 0.07
146 0.05
147 0.06
148 0.05
149 0.06
150 0.06
151 0.07
152 0.06
153 0.05
154 0.05
155 0.07
156 0.07
157 0.07
158 0.09
159 0.08
160 0.08
161 0.13
162 0.13
163 0.12
164 0.12
165 0.14
166 0.13
167 0.13
168 0.13
169 0.09
170 0.09
171 0.09
172 0.08
173 0.05
174 0.05
175 0.04
176 0.04
177 0.03
178 0.03
179 0.06
180 0.07
181 0.09
182 0.1
183 0.09
184 0.1
185 0.1
186 0.14
187 0.15
188 0.15
189 0.13
190 0.15
191 0.16
192 0.17
193 0.18
194 0.14
195 0.11
196 0.11
197 0.13
198 0.11
199 0.11
200 0.1
201 0.09
202 0.09
203 0.09
204 0.09
205 0.07
206 0.06
207 0.06
208 0.06
209 0.06
210 0.06
211 0.06
212 0.06
213 0.05
214 0.04
215 0.05
216 0.05
217 0.05
218 0.06
219 0.09
220 0.12
221 0.13
222 0.15
223 0.16
224 0.17
225 0.18
226 0.18
227 0.22
228 0.25
229 0.31
230 0.33
231 0.38
232 0.39
233 0.41
234 0.41
235 0.36
236 0.33
237 0.28
238 0.25
239 0.27
240 0.32
241 0.3
242 0.29
243 0.3
244 0.28
245 0.28
246 0.28
247 0.19
248 0.15
249 0.14
250 0.13
251 0.13
252 0.12
253 0.09
254 0.1
255 0.12
256 0.14
257 0.16
258 0.17
259 0.2
260 0.29
261 0.35
262 0.38
263 0.4
264 0.46
265 0.49
266 0.5
267 0.48
268 0.39
269 0.39
270 0.39
271 0.39
272 0.33
273 0.28
274 0.29
275 0.31
276 0.32
277 0.28
278 0.3
279 0.29
280 0.29
281 0.31
282 0.28
283 0.28
284 0.35
285 0.34
286 0.28
287 0.29
288 0.28
289 0.27
290 0.29
291 0.29
292 0.21
293 0.21
294 0.22
295 0.19
296 0.21
297 0.22
298 0.21
299 0.21
300 0.22
301 0.25
302 0.27
303 0.27
304 0.26
305 0.25
306 0.25
307 0.26
308 0.29
309 0.3
310 0.36
311 0.36
312 0.37
313 0.43