Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1PP31

Protein Details
Accession A0A4Z1PP31    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-83IQHHSGRKSCQRLPKRQQYSNHIPSVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MCNKPSSLFRRRSQIACQSELTTVLGATEISESIANVTSPIESQASPYQLTIERITIQHHSGRKSCQRLPKRQQYSNHIPSVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.61
3 0.56
4 0.53
5 0.45
6 0.4
7 0.37
8 0.3
9 0.2
10 0.14
11 0.1
12 0.08
13 0.06
14 0.06
15 0.05
16 0.04
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.06
28 0.06
29 0.06
30 0.08
31 0.1
32 0.12
33 0.12
34 0.12
35 0.13
36 0.14
37 0.16
38 0.15
39 0.14
40 0.14
41 0.14
42 0.16
43 0.17
44 0.18
45 0.21
46 0.23
47 0.27
48 0.29
49 0.36
50 0.43
51 0.48
52 0.52
53 0.58
54 0.64
55 0.71
56 0.79
57 0.82
58 0.83
59 0.83
60 0.85
61 0.84
62 0.85
63 0.82