Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1P4L5

Protein Details
Accession A0A4Z1P4L5   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-61RKPSEDPPERKPNRNHRAGAGRNRARKRVKKDKPNNTVFTPBasic
NLS Segment(s)
PositionSequence
18-53GPPRKPSEDPPERKPNRNHRAGAGRNRARKRVKKDK
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MGPIRKTSAYASRTRSTGPPRKPSEDPPERKPNRNHRAGAGRNRARKRVKKDKPNNTVFTPEESEDSENMQVTAAVEQEPWPDLEPAAAFGLETRDFAPSALGARLGTAMASRRRAYSAPSASTTPIIRRGRGLSTVARIDFGAMTAEALVYTVQRAADEMDRRMRITSIEGEAPERKRKFENGGDGGTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.51
4 0.56
5 0.58
6 0.61
7 0.65
8 0.7
9 0.71
10 0.72
11 0.73
12 0.74
13 0.72
14 0.7
15 0.74
16 0.74
17 0.78
18 0.79
19 0.79
20 0.78
21 0.8
22 0.74
23 0.7
24 0.75
25 0.75
26 0.75
27 0.74
28 0.72
29 0.73
30 0.75
31 0.77
32 0.77
33 0.77
34 0.77
35 0.78
36 0.8
37 0.82
38 0.88
39 0.9
40 0.9
41 0.89
42 0.84
43 0.75
44 0.71
45 0.6
46 0.54
47 0.46
48 0.36
49 0.28
50 0.25
51 0.24
52 0.18
53 0.19
54 0.15
55 0.12
56 0.11
57 0.1
58 0.08
59 0.07
60 0.07
61 0.06
62 0.05
63 0.05
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.06
76 0.05
77 0.05
78 0.07
79 0.06
80 0.07
81 0.06
82 0.07
83 0.07
84 0.07
85 0.07
86 0.06
87 0.07
88 0.06
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.08
97 0.11
98 0.15
99 0.15
100 0.16
101 0.18
102 0.19
103 0.22
104 0.26
105 0.28
106 0.27
107 0.28
108 0.29
109 0.28
110 0.29
111 0.27
112 0.2
113 0.25
114 0.25
115 0.23
116 0.25
117 0.27
118 0.27
119 0.28
120 0.29
121 0.23
122 0.25
123 0.28
124 0.25
125 0.24
126 0.21
127 0.19
128 0.16
129 0.13
130 0.1
131 0.07
132 0.07
133 0.06
134 0.06
135 0.05
136 0.05
137 0.05
138 0.04
139 0.04
140 0.05
141 0.06
142 0.06
143 0.06
144 0.09
145 0.15
146 0.19
147 0.22
148 0.29
149 0.3
150 0.32
151 0.32
152 0.3
153 0.25
154 0.26
155 0.26
156 0.22
157 0.23
158 0.23
159 0.27
160 0.32
161 0.36
162 0.42
163 0.4
164 0.4
165 0.41
166 0.46
167 0.5
168 0.52
169 0.58
170 0.54