Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1NEN4

Protein Details
Accession A0A4Z1NEN4    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-75PTSPTDREKKQVKRQQRKTEFNKVRTVQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, mito_nucl 12.166, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MSFPTARNSTDTASTTTTTTTTSSLQKPKNQPSSKQPSLFTRLFHSPPTSPTDREKKQVKRQQRKTEFNKVRTVQNSMMVAQVGNPLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.21
4 0.19
5 0.16
6 0.15
7 0.14
8 0.14
9 0.18
10 0.24
11 0.31
12 0.36
13 0.43
14 0.51
15 0.58
16 0.66
17 0.66
18 0.64
19 0.66
20 0.71
21 0.69
22 0.64
23 0.57
24 0.51
25 0.54
26 0.5
27 0.41
28 0.35
29 0.32
30 0.3
31 0.29
32 0.27
33 0.21
34 0.22
35 0.27
36 0.26
37 0.24
38 0.29
39 0.37
40 0.37
41 0.44
42 0.51
43 0.55
44 0.63
45 0.7
46 0.75
47 0.77
48 0.85
49 0.88
50 0.9
51 0.91
52 0.88
53 0.9
54 0.89
55 0.83
56 0.82
57 0.73
58 0.71
59 0.64
60 0.62
61 0.53
62 0.49
63 0.46
64 0.36
65 0.35
66 0.27
67 0.23
68 0.18