Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1P303

Protein Details
Accession A0A4Z1P303    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
60-107EDDSKAKTKKRKLQDSPGDGSHGTSPIRIRKTKKRAKKKDAIDDLFQGHydrophilic
NLS Segment(s)
PositionSequence
65-73AKTKKRKLQ
81-98HGTSPIRIRKTKKRAKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 17, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MVEEGEDIGVELRGFKEIQVVDEALRGSEDDIGVPILRDKNNDLGEVVVREDEDVLVKVEDDSKAKTKKRKLQDSPGDGSHGTSPIRIRKTKKRAKKKDAIDDLFQGLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.13
4 0.13
5 0.15
6 0.16
7 0.17
8 0.15
9 0.17
10 0.17
11 0.12
12 0.11
13 0.1
14 0.08
15 0.08
16 0.08
17 0.06
18 0.06
19 0.07
20 0.07
21 0.07
22 0.09
23 0.11
24 0.12
25 0.13
26 0.14
27 0.2
28 0.21
29 0.21
30 0.19
31 0.16
32 0.16
33 0.15
34 0.14
35 0.07
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.07
48 0.08
49 0.1
50 0.16
51 0.23
52 0.28
53 0.36
54 0.44
55 0.52
56 0.62
57 0.7
58 0.72
59 0.76
60 0.81
61 0.8
62 0.75
63 0.68
64 0.6
65 0.49
66 0.42
67 0.32
68 0.25
69 0.18
70 0.16
71 0.19
72 0.24
73 0.31
74 0.36
75 0.42
76 0.51
77 0.62
78 0.71
79 0.77
80 0.81
81 0.86
82 0.9
83 0.92
84 0.92
85 0.92
86 0.92
87 0.87
88 0.8
89 0.72