Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1NCK9

Protein Details
Accession A0A4Z1NCK9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
33-57APTEPKPKPVPAKGKKQTKAEKAAEHydrophilic
NLS Segment(s)
PositionSequence
37-67PKPKPVPAKGKKQTKAEKAAEEKPIAKQKER
Subcellular Location(s) nucl 18.5, mito_nucl 13, mito 6.5
Family & Domain DBs
Amino Acid Sequences MAGKKDTSSEKKPTRISTRLTNSRAVATPAPSAPTEPKPKPVPAKGKKQTKAEKAAEEKPIAKQKEREREEDQDRADGSGALEPALQLGVRRSTRESRSPTKPTTRITRSIETIKEESGNSEQGSISPSSGAVSTKVPEKQKRSPADERRFQDAKQEAARQRADEDGRFQDAKQXXXXEQGYHAPNKAIMPRTRLSCAEQGYHAPNKALMLRSINSTRYLSATIRETYAILSLQYAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.72
3 0.7
4 0.7
5 0.72
6 0.73
7 0.7
8 0.66
9 0.58
10 0.56
11 0.52
12 0.46
13 0.38
14 0.31
15 0.31
16 0.26
17 0.27
18 0.23
19 0.24
20 0.25
21 0.3
22 0.37
23 0.35
24 0.42
25 0.45
26 0.52
27 0.58
28 0.62
29 0.66
30 0.65
31 0.74
32 0.76
33 0.82
34 0.82
35 0.83
36 0.83
37 0.81
38 0.82
39 0.76
40 0.75
41 0.7
42 0.69
43 0.65
44 0.58
45 0.51
46 0.47
47 0.51
48 0.46
49 0.44
50 0.45
51 0.49
52 0.57
53 0.59
54 0.59
55 0.57
56 0.62
57 0.63
58 0.62
59 0.54
60 0.46
61 0.42
62 0.36
63 0.3
64 0.22
65 0.17
66 0.12
67 0.11
68 0.08
69 0.08
70 0.07
71 0.06
72 0.06
73 0.05
74 0.04
75 0.05
76 0.11
77 0.12
78 0.14
79 0.17
80 0.23
81 0.28
82 0.35
83 0.41
84 0.42
85 0.5
86 0.55
87 0.56
88 0.58
89 0.59
90 0.56
91 0.58
92 0.56
93 0.55
94 0.54
95 0.51
96 0.46
97 0.45
98 0.42
99 0.37
100 0.33
101 0.26
102 0.22
103 0.19
104 0.18
105 0.15
106 0.15
107 0.11
108 0.11
109 0.1
110 0.09
111 0.11
112 0.09
113 0.08
114 0.07
115 0.06
116 0.06
117 0.07
118 0.07
119 0.06
120 0.07
121 0.08
122 0.11
123 0.16
124 0.22
125 0.29
126 0.35
127 0.42
128 0.5
129 0.55
130 0.6
131 0.66
132 0.7
133 0.73
134 0.74
135 0.7
136 0.69
137 0.64
138 0.56
139 0.55
140 0.47
141 0.42
142 0.39
143 0.43
144 0.38
145 0.43
146 0.45
147 0.37
148 0.35
149 0.35
150 0.33
151 0.27
152 0.29
153 0.25
154 0.28
155 0.28
156 0.26
157 0.29
158 0.28
159 0.29
160 0.27
161 0.26
162 0.23
163 0.3
164 0.35
165 0.3
166 0.31
167 0.28
168 0.28
169 0.28
170 0.33
171 0.33
172 0.31
173 0.34
174 0.35
175 0.39
176 0.41
177 0.41
178 0.4
179 0.38
180 0.38
181 0.34
182 0.32
183 0.32
184 0.35
185 0.37
186 0.34
187 0.29
188 0.27
189 0.27
190 0.29
191 0.27
192 0.23
193 0.23
194 0.23
195 0.29
196 0.32
197 0.31
198 0.31
199 0.3
200 0.29
201 0.26
202 0.29
203 0.24
204 0.24
205 0.27
206 0.25
207 0.25
208 0.24
209 0.22
210 0.2
211 0.21
212 0.17
213 0.13