Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1NCM9

Protein Details
Accession A0A4Z1NCM9   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-40LLWKIPWRLSKFQKNRQRLRLRRIDSHydrophilic
76-105DKYTIFDRKVRKYRKGIHKLPKWTRVSQRLHydrophilic
NLS Segment(s)
PositionSequence
84-95KVRKYRKGIHKL
Subcellular Location(s) mito 21.5, cyto_mito 12.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFKLSTPLSGGLLWKIPWRLSKFQKNRQRLRLRRIDSIVATVDSALKKQGVTTKAVELWKQEMPTEPEMLAKDKYTIFDRKVRKYRKGIHKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.18
5 0.19
6 0.2
7 0.26
8 0.31
9 0.38
10 0.46
11 0.56
12 0.62
13 0.7
14 0.78
15 0.81
16 0.84
17 0.86
18 0.88
19 0.86
20 0.86
21 0.85
22 0.8
23 0.76
24 0.7
25 0.63
26 0.52
27 0.46
28 0.37
29 0.27
30 0.22
31 0.15
32 0.14
33 0.1
34 0.1
35 0.08
36 0.08
37 0.07
38 0.08
39 0.14
40 0.13
41 0.16
42 0.17
43 0.18
44 0.21
45 0.22
46 0.22
47 0.18
48 0.19
49 0.18
50 0.18
51 0.16
52 0.16
53 0.19
54 0.2
55 0.2
56 0.17
57 0.17
58 0.18
59 0.2
60 0.18
61 0.14
62 0.14
63 0.14
64 0.16
65 0.19
66 0.23
67 0.24
68 0.31
69 0.39
70 0.47
71 0.56
72 0.62
73 0.67
74 0.72
75 0.78
76 0.82
77 0.85
78 0.85
79 0.86
80 0.86
81 0.88
82 0.88
83 0.87
84 0.82
85 0.8
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79