Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1PIS5

Protein Details
Accession A0A4Z1PIS5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-111KKAAAKPKTKAAPKAKVAKKBasic
NLS Segment(s)
PositionSequence
49-111ASGRVTKPAAVKKSPVTKAKKVVKKADDKVDSAVEKTEKKVAPKKAAAKPKTKAAPKAKVAKK
Subcellular Location(s) mito 21, nucl 6
Family & Domain DBs
Amino Acid Sequences MASTTTARSKTRSQSGITVPRKVEAVAESTGPKKSTKANTSKPRTEAVASGRVTKPAAVKKSPVTKAKKVVKKADDKVDSAVEKTEKKVAPKKAAAKPKTKAAPKAKVAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.57
3 0.63
4 0.61
5 0.58
6 0.5
7 0.47
8 0.44
9 0.37
10 0.3
11 0.21
12 0.2
13 0.15
14 0.15
15 0.16
16 0.17
17 0.19
18 0.19
19 0.18
20 0.16
21 0.22
22 0.29
23 0.36
24 0.44
25 0.52
26 0.61
27 0.69
28 0.72
29 0.68
30 0.61
31 0.54
32 0.46
33 0.39
34 0.32
35 0.31
36 0.27
37 0.29
38 0.27
39 0.26
40 0.25
41 0.23
42 0.23
43 0.21
44 0.25
45 0.22
46 0.24
47 0.28
48 0.36
49 0.41
50 0.45
51 0.47
52 0.49
53 0.57
54 0.64
55 0.66
56 0.65
57 0.68
58 0.67
59 0.7
60 0.7
61 0.7
62 0.64
63 0.58
64 0.54
65 0.49
66 0.42
67 0.33
68 0.31
69 0.24
70 0.22
71 0.23
72 0.28
73 0.26
74 0.33
75 0.41
76 0.46
77 0.51
78 0.58
79 0.66
80 0.67
81 0.75
82 0.74
83 0.76
84 0.72
85 0.73
86 0.74
87 0.72
88 0.74
89 0.73
90 0.76
91 0.76