Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LLD0

Protein Details
Accession E2LLD0   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-38AQKRQRITRACDTCRRKKIRCNGVQMPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG mpr:MPER_07533  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MFSDEEITHHVAQKRQRITRACDTCRRKKIRCNGVQMPGIRCSPCTASGSDCTYAKAARFTETRSSNNVRPVSIRLLTLGELEDLISYFEDLAFKREQTQRTPRQLLPKNLGLTAEHNLPEAPIPSSIPHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.59
4 0.6
5 0.64
6 0.7
7 0.73
8 0.71
9 0.72
10 0.75
11 0.77
12 0.81
13 0.82
14 0.78
15 0.78
16 0.81
17 0.82
18 0.81
19 0.8
20 0.77
21 0.75
22 0.73
23 0.67
24 0.6
25 0.52
26 0.45
27 0.36
28 0.29
29 0.24
30 0.21
31 0.2
32 0.19
33 0.17
34 0.17
35 0.2
36 0.23
37 0.22
38 0.2
39 0.19
40 0.18
41 0.18
42 0.15
43 0.16
44 0.13
45 0.15
46 0.15
47 0.17
48 0.23
49 0.26
50 0.28
51 0.29
52 0.33
53 0.33
54 0.39
55 0.37
56 0.3
57 0.28
58 0.29
59 0.28
60 0.24
61 0.21
62 0.15
63 0.15
64 0.15
65 0.13
66 0.11
67 0.07
68 0.06
69 0.06
70 0.05
71 0.05
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.06
78 0.06
79 0.09
80 0.1
81 0.1
82 0.17
83 0.23
84 0.26
85 0.33
86 0.43
87 0.5
88 0.58
89 0.64
90 0.61
91 0.67
92 0.72
93 0.71
94 0.68
95 0.65
96 0.57
97 0.52
98 0.49
99 0.4
100 0.35
101 0.3
102 0.27
103 0.21
104 0.19
105 0.19
106 0.18
107 0.18
108 0.16
109 0.14
110 0.12
111 0.13