FuNGI

A0A4Z1NY69

Protein Details

Accession

A0A4Z1NY69

Localization Confidence

Medium

Confidence Score

13.8

NoLS Segment(s)

Position	Sequence	Protein Nature
505-525	TLPAPRQWRGVPKKYRAGRVS	Hydrophilic

NLS Segment(s)

Position	Sequence
234-256	KPKPAPPIGKKPPLPPPASRKPS

Subcellular Location(s)

nucl 22, cyto_nucl 13, mito 3

Family & Domain DBs

InterPro	View protein in InterPro IPR003124 WH2_dom
Gene Ontology	GO:0030479 C:actin cortical patch GO:0003779 F:actin binding
Pfam	View protein in Pfam PF02205 WH2
PROSITE	View protein in PROSITE PS51082 WH2

Amino Acid Sequences

MPPPPPPPPMPGMVRGAGGPPPPPMPPPGGLPGKKQIQGAGRGALLSSIEGGARLKKVVVNDRSAPIIDAKISAPAAPAMGAPPVPGMGKRPAAPGGLAPPPPPGGNRARSNSDGVDSGGAAMASAPQLGGIFAGGMPKLRKTGGGVATGRDTEPSPYQSDPETSRNSAPRPPMGGSGLKPTGAPPRVPGSAPPLPPGAAPAAPGVAALRNNLRSQSERPSSSASFSSFNSSGKPKPAPPIGKKPPLPPPASRKPSGLAPTPPQLSPIPPTAPPPPPGSAPRPPVRSTPPPPPLPPSANSAAPPSLAAQAARNAFSRSTTSPAAPPPPPPPGSAPTPPHQRKDSEDSDYDPYNHNSTPSRAPPAPALPPAPALPPPRPSSTAPPPPPLPPTGPPSRPPMHMKSMLDIGAHASPLPRPPPPPNAPSVQPLGALANVSSYTLTNGRTSSMSTVGNGNGRANSMTAASGLGNGFGHGNGLGGGGNGLGNGTGVVKIHDLRWKFQDETTLPAPRQWRGVPKKYRAGRVSSVPLDLRGYE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.38
2	0.33
3	0.3
4	0.28
5	0.25
6	0.21
7	0.19
8	0.2
9	0.21
10	0.23
11	0.24
12	0.25
13	0.25
14	0.28
15	0.33
16	0.4
17	0.41
18	0.45
19	0.5
20	0.53
21	0.54
22	0.5
23	0.48
24	0.45
25	0.5
26	0.48
27	0.42
28	0.35
29	0.32
30	0.31
31	0.25
32	0.19
33	0.12
34	0.1
35	0.07
36	0.07
37	0.07
38	0.09
39	0.11
40	0.12
41	0.13
42	0.13
43	0.15
44	0.21
45	0.31
46	0.35
47	0.38
48	0.41
49	0.42
50	0.43
51	0.41
52	0.36
53	0.29
54	0.25
55	0.19
56	0.16
57	0.15
58	0.16
59	0.16
60	0.15
61	0.13
62	0.12
63	0.12
64	0.1
65	0.1
66	0.08
67	0.08
68	0.08
69	0.07
70	0.07
71	0.08
72	0.09
73	0.09
74	0.12
75	0.17
76	0.2
77	0.21
78	0.24
79	0.25
80	0.25
81	0.25
82	0.23
83	0.22
84	0.24
85	0.24
86	0.21
87	0.21
88	0.22
89	0.22
90	0.21
91	0.22
92	0.25
93	0.31
94	0.38
95	0.41
96	0.45
97	0.46
98	0.49
99	0.44
100	0.38
101	0.31
102	0.25
103	0.21
104	0.15
105	0.13
106	0.1
107	0.08
108	0.06
109	0.05
110	0.05
111	0.04
112	0.04
113	0.04
114	0.04
115	0.04
116	0.04
117	0.04
118	0.03
119	0.03
120	0.04
121	0.05
122	0.05
123	0.08
124	0.09
125	0.1
126	0.12
127	0.12
128	0.13
129	0.15
130	0.23
131	0.24
132	0.29
133	0.29
134	0.29
135	0.3
136	0.3
137	0.27
138	0.2
139	0.17
140	0.13
141	0.16
142	0.17
143	0.18
144	0.18
145	0.19
146	0.19
147	0.22
148	0.23
149	0.26
150	0.28
151	0.28
152	0.32
153	0.35
154	0.36
155	0.37
156	0.37
157	0.35
158	0.34
159	0.33
160	0.31
161	0.29
162	0.3
163	0.26
164	0.28
165	0.26
166	0.22
167	0.21
168	0.2
169	0.25
170	0.24
171	0.24
172	0.2
173	0.24
174	0.25
175	0.25
176	0.25
177	0.24
178	0.28
179	0.28
180	0.28
181	0.24
182	0.23
183	0.22
184	0.22
185	0.16
186	0.11
187	0.11
188	0.09
189	0.08
190	0.08
191	0.08
192	0.07
193	0.06
194	0.07
195	0.07
196	0.1
197	0.12
198	0.12
199	0.14
200	0.16
201	0.17
202	0.2
203	0.28
204	0.3
205	0.3
206	0.31
207	0.34
208	0.33
209	0.32
210	0.3
211	0.24
212	0.2
213	0.19
214	0.22
215	0.18
216	0.18
217	0.18
218	0.2
219	0.2
220	0.23
221	0.25
222	0.22
223	0.27
224	0.34
225	0.4
226	0.43
227	0.52
228	0.55
229	0.61
230	0.61
231	0.6
232	0.63
233	0.61
234	0.59
235	0.53
236	0.54
237	0.57
238	0.59
239	0.56
240	0.47
241	0.42
242	0.43
243	0.41
244	0.36
245	0.29
246	0.27
247	0.29
248	0.3
249	0.28
250	0.26
251	0.23
252	0.2
253	0.19
254	0.19
255	0.16
256	0.15
257	0.18
258	0.2
259	0.23
260	0.24
261	0.24
262	0.23
263	0.24
264	0.27
265	0.3
266	0.31
267	0.35
268	0.38
269	0.39
270	0.39
271	0.41
272	0.43
273	0.46
274	0.44
275	0.48
276	0.49
277	0.48
278	0.48
279	0.49
280	0.47
281	0.41
282	0.39
283	0.34
284	0.3
285	0.28
286	0.27
287	0.24
288	0.2
289	0.17
290	0.16
291	0.12
292	0.11
293	0.1
294	0.09
295	0.08
296	0.12
297	0.13
298	0.14
299	0.14
300	0.13
301	0.13
302	0.14
303	0.17
304	0.14
305	0.17
306	0.17
307	0.18
308	0.19
309	0.22
310	0.25
311	0.23
312	0.25
313	0.24
314	0.29
315	0.29
316	0.28
317	0.29
318	0.28
319	0.32
320	0.35
321	0.36
322	0.37
323	0.46
324	0.49
325	0.5
326	0.49
327	0.47
328	0.46
329	0.5
330	0.48
331	0.42
332	0.4
333	0.38
334	0.38
335	0.37
336	0.33
337	0.28
338	0.25
339	0.23
340	0.22
341	0.21
342	0.19
343	0.21
344	0.26
345	0.26
346	0.31
347	0.29
348	0.3
349	0.31
350	0.33
351	0.33
352	0.29
353	0.28
354	0.22
355	0.23
356	0.22
357	0.21
358	0.21
359	0.22
360	0.23
361	0.27
362	0.3
363	0.32
364	0.35
365	0.36
366	0.39
367	0.45
368	0.52
369	0.5
370	0.52
371	0.5
372	0.5
373	0.5
374	0.45
375	0.39
376	0.33
377	0.36
378	0.39
379	0.4
380	0.4
381	0.45
382	0.45
383	0.46
384	0.48
385	0.48
386	0.47
387	0.5
388	0.48
389	0.43
390	0.43
391	0.39
392	0.32
393	0.26
394	0.21
395	0.15
396	0.14
397	0.12
398	0.09
399	0.1
400	0.14
401	0.17
402	0.17
403	0.21
404	0.27
405	0.36
406	0.42
407	0.44
408	0.44
409	0.46
410	0.46
411	0.45
412	0.43
413	0.34
414	0.28
415	0.25
416	0.22
417	0.18
418	0.15
419	0.11
420	0.09
421	0.08
422	0.08
423	0.08
424	0.07
425	0.09
426	0.11
427	0.12
428	0.13
429	0.13
430	0.15
431	0.15
432	0.17
433	0.17
434	0.18
435	0.17
436	0.16
437	0.19
438	0.19
439	0.22
440	0.22
441	0.21
442	0.18
443	0.18
444	0.18
445	0.16
446	0.14
447	0.12
448	0.11
449	0.09
450	0.09
451	0.08
452	0.09
453	0.09
454	0.09
455	0.08
456	0.08
457	0.09
458	0.08
459	0.08
460	0.06
461	0.07
462	0.06
463	0.06
464	0.06
465	0.05
466	0.05
467	0.05
468	0.05
469	0.04
470	0.04
471	0.04
472	0.04
473	0.04
474	0.05
475	0.05
476	0.05
477	0.07
478	0.09
479	0.11
480	0.15
481	0.21
482	0.23
483	0.27
484	0.33
485	0.37
486	0.37
487	0.38
488	0.44
489	0.39
490	0.43
491	0.45
492	0.46
493	0.41
494	0.43
495	0.45
496	0.38
497	0.43
498	0.42
499	0.46
500	0.49
501	0.6
502	0.65
503	0.71
504	0.79
505	0.8
506	0.85
507	0.79
508	0.77
509	0.72
510	0.7
511	0.7
512	0.62
513	0.59
514	0.5
515	0.47

A0A4Z1NY69

3D AlphaFold-predicted Structure Viewer