Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1P8U6

Protein Details
Accession A0A4Z1P8U6    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-45FGKVFTARAKKQKRKTRSPSSSPSKVHydrophilic
NLS Segment(s)
PositionSequence
27-37RAKKQKRKTRS
Subcellular Location(s) mito 18.5, cyto_mito 11.333, nucl 5.5, cyto_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MLIYLSSSHHRHTHPINRLFGKVFTARAKKQKRKTRSPSSSPSKVAQSSRLIASASCLEMGPGNGLNWSRLHKMCLVSGTTPPTPLRRFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.63
4 0.6
5 0.61
6 0.57
7 0.48
8 0.42
9 0.34
10 0.31
11 0.31
12 0.35
13 0.38
14 0.47
15 0.57
16 0.62
17 0.7
18 0.76
19 0.78
20 0.82
21 0.87
22 0.88
23 0.86
24 0.84
25 0.84
26 0.82
27 0.78
28 0.7
29 0.62
30 0.54
31 0.48
32 0.41
33 0.35
34 0.29
35 0.26
36 0.23
37 0.22
38 0.18
39 0.15
40 0.16
41 0.13
42 0.1
43 0.09
44 0.08
45 0.07
46 0.08
47 0.08
48 0.08
49 0.07
50 0.07
51 0.08
52 0.09
53 0.1
54 0.11
55 0.15
56 0.19
57 0.19
58 0.22
59 0.24
60 0.26
61 0.27
62 0.28
63 0.28
64 0.25
65 0.28
66 0.31
67 0.28
68 0.29
69 0.3
70 0.34