Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1NWM1

Protein Details
Accession A0A4Z1NWM1   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
3-30AAKSHVPIVKKHRKRFNRHQSDRFKCVDHydrophilic
NLS Segment(s)
PositionSequence
12-17KKHRKR
Subcellular Location(s) mito 14, cyto 9.5, cyto_nucl 7, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKSHVPIVKKHRKRFNRHQSDRFKCVDASWRKPKGIDNRVRRRFSGQAAMPKIGYGSNKKTRHMMPSGHKAFLVNNVREVDLLLMHNRTYAAEIAHAVSARKRIDIIARAKELGVKVTNSKARVTTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.77
3 0.86
4 0.9
5 0.9
6 0.91
7 0.91
8 0.92
9 0.92
10 0.9
11 0.86
12 0.78
13 0.69
14 0.58
15 0.5
16 0.49
17 0.47
18 0.48
19 0.52
20 0.54
21 0.52
22 0.53
23 0.59
24 0.59
25 0.61
26 0.61
27 0.62
28 0.68
29 0.76
30 0.78
31 0.72
32 0.67
33 0.6
34 0.54
35 0.52
36 0.44
37 0.43
38 0.43
39 0.42
40 0.36
41 0.32
42 0.28
43 0.21
44 0.2
45 0.16
46 0.21
47 0.3
48 0.32
49 0.34
50 0.37
51 0.38
52 0.41
53 0.4
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.31
62 0.33
63 0.34
64 0.24
65 0.24
66 0.25
67 0.25
68 0.24
69 0.24
70 0.16
71 0.1
72 0.1
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.09
81 0.08
82 0.08
83 0.09
84 0.09
85 0.1
86 0.11
87 0.1
88 0.11
89 0.16
90 0.16
91 0.16
92 0.16
93 0.17
94 0.23
95 0.3
96 0.36
97 0.37
98 0.39
99 0.39
100 0.39
101 0.4
102 0.35
103 0.32
104 0.27
105 0.22
106 0.24
107 0.31
108 0.36
109 0.35
110 0.36
111 0.35