Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1PF38

Protein Details
Accession A0A4Z1PF38   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-22STTTRIAKRELRKQLKRALASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002698  FTHF_cligase  
IPR024185  FTHF_cligase-like_sf  
IPR037171  NagB/RpiA_transferase-like  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016874  F:ligase activity  
Pfam View protein in Pfam  
PF01812  5-FTHF_cyc-lig  
Amino Acid Sequences MSTTTRIAKRELRKQLKRALASIPNESVTHQRSKKTVPPNQLDQAVQPRQIMDMLELNDLQDYEGLELDAWGIPTPSEASLNERKNCFGGYGKSEDLDVEEADAEDELDLIITPGLGFDRNLGRTGRGMGFYDYFFQRCGKSQRRGKVPWKVGLALNEQVLPADQTVPMDETDQRIDALILGDGSVLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.77
5 0.7
6 0.67
7 0.63
8 0.58
9 0.55
10 0.47
11 0.4
12 0.37
13 0.35
14 0.34
15 0.3
16 0.35
17 0.34
18 0.36
19 0.38
20 0.43
21 0.5
22 0.54
23 0.57
24 0.58
25 0.61
26 0.65
27 0.65
28 0.63
29 0.55
30 0.48
31 0.5
32 0.43
33 0.38
34 0.31
35 0.27
36 0.24
37 0.24
38 0.21
39 0.13
40 0.14
41 0.13
42 0.14
43 0.14
44 0.13
45 0.12
46 0.12
47 0.1
48 0.07
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.05
62 0.06
63 0.05
64 0.06
65 0.06
66 0.12
67 0.2
68 0.26
69 0.29
70 0.29
71 0.29
72 0.28
73 0.28
74 0.24
75 0.19
76 0.16
77 0.15
78 0.18
79 0.18
80 0.17
81 0.17
82 0.15
83 0.13
84 0.12
85 0.09
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.04
92 0.03
93 0.03
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.03
103 0.03
104 0.04
105 0.06
106 0.09
107 0.1
108 0.13
109 0.13
110 0.14
111 0.14
112 0.17
113 0.17
114 0.15
115 0.15
116 0.15
117 0.16
118 0.16
119 0.18
120 0.16
121 0.16
122 0.15
123 0.15
124 0.15
125 0.19
126 0.28
127 0.34
128 0.43
129 0.5
130 0.58
131 0.66
132 0.73
133 0.77
134 0.78
135 0.76
136 0.73
137 0.69
138 0.62
139 0.56
140 0.51
141 0.47
142 0.38
143 0.32
144 0.25
145 0.21
146 0.19
147 0.16
148 0.13
149 0.1
150 0.08
151 0.08
152 0.08
153 0.09
154 0.11
155 0.11
156 0.12
157 0.13
158 0.15
159 0.17
160 0.17
161 0.16
162 0.15
163 0.15
164 0.13
165 0.13
166 0.1
167 0.08
168 0.07
169 0.07