Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1PBP6

Protein Details
Accession A0A4Z1PBP6    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
51-82ATPPSTPFVKRKKPRVPRAPMKPRRSSRQVQDHydrophilic
NLS Segment(s)
PositionSequence
60-76KRKKPRVPRAPMKPRRS
Subcellular Location(s) nucl 13, mito 7, cyto 6
Family & Domain DBs
Amino Acid Sequences MPSRFDELFLEPFLPAPVMKRAPRLFEVFRDPEDPALHPDAPRTPVRAASATPPSTPFVKRKKPRVPRAPMKPRRSSRQVQDSSSSPCAHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.11
3 0.11
4 0.16
5 0.21
6 0.23
7 0.31
8 0.33
9 0.37
10 0.4
11 0.43
12 0.39
13 0.37
14 0.43
15 0.37
16 0.36
17 0.34
18 0.31
19 0.27
20 0.26
21 0.23
22 0.19
23 0.2
24 0.19
25 0.17
26 0.18
27 0.18
28 0.2
29 0.2
30 0.19
31 0.16
32 0.17
33 0.19
34 0.19
35 0.17
36 0.18
37 0.23
38 0.21
39 0.21
40 0.21
41 0.21
42 0.22
43 0.25
44 0.28
45 0.32
46 0.42
47 0.5
48 0.59
49 0.68
50 0.76
51 0.84
52 0.87
53 0.88
54 0.88
55 0.91
56 0.92
57 0.91
58 0.9
59 0.89
60 0.87
61 0.85
62 0.83
63 0.8
64 0.79
65 0.8
66 0.77
67 0.71
68 0.68
69 0.62
70 0.61
71 0.57