Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1PDI9

Protein Details
Accession A0A4Z1PDI9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
27-50TPQGKIGATPKKRKSTKKSEDTVDHydrophilic
NLS Segment(s)
PositionSequence
36-44PKKRKSTKK
Subcellular Location(s) nucl 10.5, cyto_nucl 10.5, cyto 7.5, pero 5, mito 3
Family & Domain DBs
Amino Acid Sequences MSSIDPRDLELGVKQEDTGEPALSAATPQGKIGATPKKRKSTKKSEDTVDGEDKPSPTKKQKTPVAAKGIPDRYEDLSKEDKMMITWKEEGKSWKAIQEAWFTMTGNKHTGLTTRYIRVKAAIARVKDDDLEALEKSMAMAKERIEVEKKMVEKRLWAFVAEGMESEGAEKYDLPTLDKAWKRLQANNKAGTSKCGNTATVTGEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.2
5 0.18
6 0.14
7 0.12
8 0.12
9 0.12
10 0.1
11 0.1
12 0.09
13 0.11
14 0.11
15 0.11
16 0.13
17 0.13
18 0.14
19 0.21
20 0.29
21 0.35
22 0.44
23 0.53
24 0.61
25 0.7
26 0.79
27 0.82
28 0.83
29 0.85
30 0.85
31 0.83
32 0.78
33 0.78
34 0.71
35 0.67
36 0.6
37 0.5
38 0.42
39 0.37
40 0.32
41 0.28
42 0.28
43 0.29
44 0.34
45 0.42
46 0.47
47 0.55
48 0.61
49 0.67
50 0.72
51 0.73
52 0.72
53 0.66
54 0.62
55 0.61
56 0.57
57 0.49
58 0.41
59 0.36
60 0.3
61 0.3
62 0.28
63 0.25
64 0.25
65 0.24
66 0.23
67 0.21
68 0.18
69 0.16
70 0.2
71 0.16
72 0.14
73 0.17
74 0.18
75 0.18
76 0.2
77 0.22
78 0.21
79 0.25
80 0.23
81 0.23
82 0.22
83 0.23
84 0.23
85 0.24
86 0.22
87 0.18
88 0.18
89 0.15
90 0.17
91 0.16
92 0.15
93 0.12
94 0.12
95 0.11
96 0.11
97 0.13
98 0.12
99 0.16
100 0.17
101 0.2
102 0.23
103 0.23
104 0.23
105 0.23
106 0.24
107 0.22
108 0.28
109 0.28
110 0.25
111 0.27
112 0.28
113 0.27
114 0.25
115 0.22
116 0.14
117 0.11
118 0.12
119 0.09
120 0.09
121 0.08
122 0.07
123 0.07
124 0.1
125 0.09
126 0.09
127 0.11
128 0.11
129 0.16
130 0.17
131 0.2
132 0.2
133 0.21
134 0.23
135 0.26
136 0.29
137 0.29
138 0.34
139 0.31
140 0.34
141 0.36
142 0.39
143 0.35
144 0.33
145 0.28
146 0.25
147 0.26
148 0.2
149 0.17
150 0.11
151 0.1
152 0.09
153 0.09
154 0.08
155 0.06
156 0.07
157 0.07
158 0.07
159 0.12
160 0.12
161 0.14
162 0.15
163 0.18
164 0.27
165 0.3
166 0.34
167 0.36
168 0.43
169 0.44
170 0.51
171 0.58
172 0.6
173 0.65
174 0.68
175 0.66
176 0.63
177 0.6
178 0.58
179 0.54
180 0.45
181 0.43
182 0.38
183 0.34
184 0.32
185 0.34