Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1PR99

Protein Details
Accession A0A4Z1PR99    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEVKSRKAKSKVEGKRKKDPHAPKRGLSBasic
68-90ADDKKPYDKKAKEDKERYEREKEBasic
NLS Segment(s)
PositionSequence
5-27VKSRKAKSKVEGKRKKDPHAPKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPKEVKSRKAKSKVEGKRKKDPHAPKRGLSAYMFFANDNRDKVREENPGIKFGEVGKALGEKWKELSADDKKPYDKKAKEDKERYEREKEEYANKGAVDDDEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.82
4 0.82
5 0.83
6 0.83
7 0.82
8 0.83
9 0.82
10 0.83
11 0.81
12 0.73
13 0.74
14 0.68
15 0.6
16 0.5
17 0.42
18 0.33
19 0.3
20 0.27
21 0.19
22 0.18
23 0.19
24 0.2
25 0.2
26 0.19
27 0.18
28 0.19
29 0.22
30 0.25
31 0.28
32 0.29
33 0.35
34 0.34
35 0.37
36 0.35
37 0.32
38 0.28
39 0.21
40 0.21
41 0.14
42 0.12
43 0.09
44 0.09
45 0.09
46 0.13
47 0.13
48 0.09
49 0.11
50 0.13
51 0.13
52 0.12
53 0.21
54 0.24
55 0.31
56 0.34
57 0.36
58 0.39
59 0.42
60 0.48
61 0.5
62 0.48
63 0.5
64 0.58
65 0.65
66 0.71
67 0.76
68 0.8
69 0.8
70 0.85
71 0.82
72 0.8
73 0.72
74 0.68
75 0.65
76 0.59
77 0.56
78 0.52
79 0.5
80 0.43
81 0.4
82 0.35
83 0.29
84 0.26
85 0.21