Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1P7C6

Protein Details
Accession A0A4Z1P7C6   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
23-48NKLTRHTCSHCRHYRCKENYNPNGGCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001876  Znf_RanBP2  
Gene Ontology GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS01358  ZF_RANBP2_1  
Amino Acid Sequences MPKLPLKISKIVFWNCCQCDNENKLTRHTCSHCRHYRCKENYNPNGGCEDEDEEQEMMEALFDMMRTIDESRVVNEKMVCWSRKPSITSPVTTYSNMHTRTLIKLITNYERYDISLVLLASYTSTTSTLTTYNSIVDLPAVQVYHEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.49
3 0.51
4 0.48
5 0.43
6 0.45
7 0.47
8 0.51
9 0.5
10 0.5
11 0.53
12 0.56
13 0.55
14 0.54
15 0.54
16 0.54
17 0.53
18 0.62
19 0.64
20 0.67
21 0.74
22 0.76
23 0.81
24 0.79
25 0.81
26 0.8
27 0.82
28 0.82
29 0.81
30 0.72
31 0.63
32 0.56
33 0.47
34 0.38
35 0.28
36 0.24
37 0.15
38 0.14
39 0.15
40 0.12
41 0.12
42 0.11
43 0.09
44 0.06
45 0.05
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.05
54 0.05
55 0.06
56 0.07
57 0.08
58 0.09
59 0.13
60 0.13
61 0.13
62 0.13
63 0.13
64 0.16
65 0.2
66 0.19
67 0.18
68 0.21
69 0.24
70 0.28
71 0.31
72 0.29
73 0.34
74 0.36
75 0.36
76 0.36
77 0.36
78 0.34
79 0.31
80 0.3
81 0.24
82 0.28
83 0.28
84 0.25
85 0.23
86 0.22
87 0.24
88 0.25
89 0.23
90 0.17
91 0.18
92 0.22
93 0.26
94 0.28
95 0.26
96 0.25
97 0.24
98 0.25
99 0.23
100 0.19
101 0.13
102 0.13
103 0.12
104 0.1
105 0.1
106 0.08
107 0.07
108 0.08
109 0.07
110 0.06
111 0.06
112 0.07
113 0.08
114 0.09
115 0.1
116 0.12
117 0.13
118 0.13
119 0.13
120 0.13
121 0.13
122 0.12
123 0.11
124 0.1
125 0.09
126 0.1
127 0.09