Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1P5J6

Protein Details
Accession A0A4Z1P5J6   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-46AEFVRATPYKRTRSKKKVQDPPPWYQNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, mito 9, nucl 5, pero 3
Family & Domain DBs
Amino Acid Sequences MTKLTLLGIHCNRGFWWETAEFVRATPYKRTRSKKKVQDPPPWYQNLSCDIDGETERARVSAENAASRVAGGDDAPTPAANGARKPLCFDAPAAIPENHLLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.22
3 0.25
4 0.19
5 0.21
6 0.22
7 0.24
8 0.2
9 0.17
10 0.22
11 0.19
12 0.21
13 0.28
14 0.34
15 0.41
16 0.5
17 0.6
18 0.65
19 0.74
20 0.81
21 0.83
22 0.86
23 0.87
24 0.88
25 0.89
26 0.84
27 0.81
28 0.77
29 0.69
30 0.6
31 0.5
32 0.42
33 0.36
34 0.33
35 0.25
36 0.19
37 0.17
38 0.17
39 0.17
40 0.16
41 0.11
42 0.09
43 0.09
44 0.08
45 0.08
46 0.07
47 0.09
48 0.12
49 0.13
50 0.13
51 0.14
52 0.14
53 0.13
54 0.13
55 0.11
56 0.07
57 0.06
58 0.05
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.08
66 0.11
67 0.11
68 0.12
69 0.19
70 0.22
71 0.23
72 0.27
73 0.3
74 0.29
75 0.29
76 0.29
77 0.26
78 0.25
79 0.27
80 0.27
81 0.23
82 0.22