Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1PL09

Protein Details
Accession A0A4Z1PL09   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-37AVVFTTEKIRKRKQKKRELKAHQVDEIHydrophilic
NLS Segment(s)
PositionSequence
18-29KIRKRKQKKREL
Subcellular Location(s) mito 16.5, cyto_mito 11.166, cyto_nucl 5.833, nucl 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MASVLIALSAAVVFTTEKIRKRKQKKRELKAHQVDEITTVDKTVPPQYDEDLLAYKKEGLPAYAIKDQHPAHRNDKHGYASHSRNPQDLSGMRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.12
3 0.17
4 0.24
5 0.33
6 0.43
7 0.53
8 0.64
9 0.74
10 0.77
11 0.84
12 0.88
13 0.91
14 0.92
15 0.91
16 0.91
17 0.91
18 0.84
19 0.76
20 0.66
21 0.55
22 0.46
23 0.37
24 0.27
25 0.17
26 0.13
27 0.09
28 0.09
29 0.11
30 0.12
31 0.12
32 0.12
33 0.13
34 0.14
35 0.15
36 0.15
37 0.14
38 0.13
39 0.12
40 0.11
41 0.11
42 0.1
43 0.09
44 0.12
45 0.11
46 0.1
47 0.12
48 0.14
49 0.19
50 0.22
51 0.22
52 0.2
53 0.27
54 0.28
55 0.34
56 0.38
57 0.39
58 0.43
59 0.49
60 0.53
61 0.5
62 0.54
63 0.5
64 0.47
65 0.48
66 0.48
67 0.48
68 0.51
69 0.55
70 0.53
71 0.51
72 0.5
73 0.45
74 0.45