Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1PNG6

Protein Details
Accession A0A4Z1PNG6    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-54MKEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGRKBasic
NLS Segment(s)
PositionSequence
6-62KEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGRKEGKKESKE
Subcellular Location(s) mito 15, nucl 12
Family & Domain DBs
Amino Acid Sequences MKEGMKEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGKKEGRKEGKKESKETEKEKEIGNISYTVYAPETDAYLFYYLVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.75
4 0.78
5 0.81
6 0.82
7 0.82
8 0.82
9 0.82
10 0.82
11 0.82
12 0.82
13 0.82
14 0.82
15 0.82
16 0.82
17 0.82
18 0.82
19 0.82
20 0.82
21 0.82
22 0.82
23 0.82
24 0.82
25 0.82
26 0.82
27 0.82
28 0.82
29 0.82
30 0.82
31 0.82
32 0.82
33 0.82
34 0.82
35 0.81
36 0.8
37 0.78
38 0.78
39 0.78
40 0.75
41 0.74
42 0.74
43 0.74
44 0.71
45 0.7
46 0.67
47 0.66
48 0.67
49 0.67
50 0.63
51 0.58
52 0.55
53 0.51
54 0.49
55 0.41
56 0.35
57 0.31
58 0.25
59 0.2
60 0.2
61 0.19
62 0.15
63 0.13
64 0.12
65 0.11
66 0.1
67 0.1
68 0.09
69 0.1
70 0.1
71 0.11
72 0.11