Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9XR08

Protein Details
Accession A0A4Y9XR08   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
175-200SAGASTRSRTRRTRRNTRRESETAEPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, cyto_mito 9.5, nucl 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003349  JmjN  
Pfam View protein in Pfam  
PF02375  JmjN  
PROSITE View protein in PROSITE  
PS51183  JMJN  
Amino Acid Sequences MSSVSGLTPSLTPGSSRQSTPEPPVQPDHFYGADNNANLPPSPRSDGRPWLHPDDDPWAHLGIPVFKPTIEEFRDFEAYLNRVEPWGMKSGIVKVIPPKEWTDSLPPLNEQLGQVRLKNPIEQHMFGHGGLFRQENVEKRRTMSVREWAELCSKDELRAPGVDDVGLHARSANASAGASTRSRTRRTRRNTRRESETAEPDRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.24
4 0.27
5 0.32
6 0.36
7 0.41
8 0.46
9 0.42
10 0.43
11 0.5
12 0.48
13 0.46
14 0.43
15 0.41
16 0.33
17 0.31
18 0.28
19 0.26
20 0.26
21 0.23
22 0.22
23 0.19
24 0.19
25 0.18
26 0.19
27 0.17
28 0.17
29 0.22
30 0.22
31 0.27
32 0.31
33 0.4
34 0.41
35 0.47
36 0.48
37 0.49
38 0.49
39 0.44
40 0.41
41 0.39
42 0.37
43 0.29
44 0.25
45 0.2
46 0.18
47 0.19
48 0.18
49 0.14
50 0.14
51 0.15
52 0.14
53 0.13
54 0.15
55 0.15
56 0.21
57 0.19
58 0.2
59 0.19
60 0.23
61 0.25
62 0.23
63 0.22
64 0.19
65 0.18
66 0.16
67 0.16
68 0.12
69 0.11
70 0.11
71 0.11
72 0.09
73 0.12
74 0.11
75 0.11
76 0.12
77 0.13
78 0.17
79 0.16
80 0.15
81 0.16
82 0.19
83 0.2
84 0.21
85 0.21
86 0.2
87 0.21
88 0.21
89 0.22
90 0.22
91 0.22
92 0.21
93 0.2
94 0.18
95 0.18
96 0.17
97 0.12
98 0.11
99 0.13
100 0.13
101 0.14
102 0.15
103 0.19
104 0.19
105 0.21
106 0.2
107 0.23
108 0.26
109 0.26
110 0.26
111 0.25
112 0.25
113 0.22
114 0.23
115 0.16
116 0.13
117 0.13
118 0.13
119 0.09
120 0.11
121 0.14
122 0.19
123 0.24
124 0.28
125 0.28
126 0.29
127 0.37
128 0.35
129 0.38
130 0.37
131 0.41
132 0.4
133 0.41
134 0.4
135 0.34
136 0.37
137 0.33
138 0.3
139 0.26
140 0.23
141 0.22
142 0.26
143 0.26
144 0.23
145 0.23
146 0.23
147 0.19
148 0.19
149 0.17
150 0.13
151 0.14
152 0.16
153 0.15
154 0.13
155 0.11
156 0.11
157 0.12
158 0.13
159 0.11
160 0.08
161 0.08
162 0.08
163 0.09
164 0.11
165 0.12
166 0.12
167 0.2
168 0.25
169 0.32
170 0.42
171 0.51
172 0.59
173 0.69
174 0.79
175 0.82
176 0.87
177 0.91
178 0.9
179 0.89
180 0.85
181 0.82
182 0.79
183 0.78