Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9Z4X0

Protein Details
Accession A0A4Y9Z4X0   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-121STAQSKAAKKNEKRKEKRKEKRETEPVKDSBasic
NLS Segment(s)
PositionSequence
96-113SKAAKKNEKRKEKRKEKR
Subcellular Location(s) cyto 10.5, cyto_nucl 9.5, nucl 7.5, mito 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MSKPAIVPDTTVAGIAVDPRTLDRVIPESRRPDGSVRKQIKIRPGFTPQEDVRRFRGSRQQQLDTHALPKGHIIGWTPPPTSSAPKPGAAPSTAQSKAAKKNEKRKEKRKEKRETEPVKDSWEDEDEELPGTGAQDGSHSADKPNLAMAPETKKSAAVKERVEKGTTSPTTEGDDQLAEKLEKLEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.09
5 0.09
6 0.1
7 0.13
8 0.13
9 0.13
10 0.13
11 0.18
12 0.24
13 0.29
14 0.35
15 0.37
16 0.4
17 0.43
18 0.43
19 0.44
20 0.49
21 0.53
22 0.58
23 0.58
24 0.61
25 0.63
26 0.65
27 0.67
28 0.65
29 0.58
30 0.53
31 0.55
32 0.54
33 0.51
34 0.55
35 0.47
36 0.49
37 0.5
38 0.47
39 0.45
40 0.46
41 0.45
42 0.41
43 0.49
44 0.47
45 0.53
46 0.57
47 0.58
48 0.52
49 0.57
50 0.57
51 0.48
52 0.41
53 0.34
54 0.28
55 0.21
56 0.2
57 0.17
58 0.13
59 0.12
60 0.12
61 0.13
62 0.18
63 0.21
64 0.21
65 0.19
66 0.21
67 0.22
68 0.24
69 0.22
70 0.24
71 0.23
72 0.24
73 0.25
74 0.24
75 0.24
76 0.2
77 0.19
78 0.14
79 0.18
80 0.17
81 0.18
82 0.19
83 0.21
84 0.29
85 0.35
86 0.43
87 0.44
88 0.54
89 0.63
90 0.72
91 0.78
92 0.81
93 0.85
94 0.87
95 0.9
96 0.9
97 0.92
98 0.88
99 0.89
100 0.89
101 0.86
102 0.82
103 0.78
104 0.69
105 0.62
106 0.55
107 0.45
108 0.37
109 0.3
110 0.24
111 0.18
112 0.17
113 0.13
114 0.13
115 0.12
116 0.1
117 0.07
118 0.07
119 0.06
120 0.05
121 0.05
122 0.05
123 0.06
124 0.09
125 0.12
126 0.12
127 0.12
128 0.14
129 0.15
130 0.15
131 0.15
132 0.13
133 0.12
134 0.13
135 0.16
136 0.21
137 0.22
138 0.24
139 0.23
140 0.25
141 0.26
142 0.32
143 0.36
144 0.36
145 0.41
146 0.47
147 0.55
148 0.55
149 0.55
150 0.49
151 0.45
152 0.48
153 0.42
154 0.39
155 0.32
156 0.31
157 0.34
158 0.35
159 0.32
160 0.24
161 0.23
162 0.19
163 0.2
164 0.21
165 0.16
166 0.16