Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9Z1A0

Protein Details
Accession A0A4Y9Z1A0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
70-106PYPWPASKLKKSKPKPKPKSKSKPVKRPQPSRRSALGHydrophilic
NLS Segment(s)
PositionSequence
72-102PWPASKLKKSKPKPKPKSKSKPVKRPQPSRR
Subcellular Location(s) extr 11, golg 5, plas 3, E.R. 3, pero 2, nucl 1, mito 1, vacu 1, mito_nucl 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MRSSAFAAIVLLAGAMAPTIAHPIDYLYTRSPEDLSYYGLAARGDSELLARNPKQEAPKQAWQPARPPSPYPWPASKLKKSKPKPKPKSKSKPVKRPQPSRRSALGTVEEYTERRSFDFDDAELLARMELDEWDELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.02
4 0.02
5 0.03
6 0.05
7 0.05
8 0.05
9 0.06
10 0.07
11 0.09
12 0.11
13 0.14
14 0.14
15 0.16
16 0.17
17 0.18
18 0.18
19 0.16
20 0.18
21 0.16
22 0.16
23 0.15
24 0.14
25 0.14
26 0.14
27 0.13
28 0.1
29 0.09
30 0.07
31 0.06
32 0.06
33 0.07
34 0.08
35 0.1
36 0.14
37 0.14
38 0.15
39 0.17
40 0.2
41 0.25
42 0.27
43 0.31
44 0.34
45 0.41
46 0.43
47 0.48
48 0.5
49 0.46
50 0.47
51 0.49
52 0.46
53 0.41
54 0.39
55 0.36
56 0.4
57 0.41
58 0.39
59 0.36
60 0.35
61 0.41
62 0.47
63 0.52
64 0.52
65 0.57
66 0.64
67 0.7
68 0.76
69 0.8
70 0.84
71 0.86
72 0.88
73 0.91
74 0.92
75 0.94
76 0.94
77 0.95
78 0.94
79 0.94
80 0.92
81 0.92
82 0.91
83 0.91
84 0.91
85 0.91
86 0.86
87 0.81
88 0.77
89 0.72
90 0.64
91 0.58
92 0.52
93 0.43
94 0.38
95 0.34
96 0.3
97 0.24
98 0.26
99 0.23
100 0.19
101 0.17
102 0.19
103 0.19
104 0.21
105 0.23
106 0.19
107 0.2
108 0.2
109 0.2
110 0.18
111 0.16
112 0.13
113 0.1
114 0.1
115 0.08
116 0.07
117 0.08