Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9XN34

Protein Details
Accession A0A4Y9XN34   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-44EDELPVRHKKKAKKPTSLKRKAEDDBasic
NLS Segment(s)
PositionSequence
14-42SLKRKAEDELPVRHKKKAKKPTSLKRKAE
51-52KK
62-69QRRKWRKA
Subcellular Location(s) nucl 16, cyto_nucl 13.333, mito_nucl 10.499, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MSSNNAAVPESPKSLKRKAEDELPVRHKKKAKKPTSLKRKAEDDLPVRYQKKAKVVLTPEQQRRKWRKAHPAVRPDMIMSSVPIHVLGRRRRWWVPGVPRLPPLDWVLGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.48
4 0.5
5 0.49
6 0.55
7 0.58
8 0.58
9 0.6
10 0.61
11 0.66
12 0.64
13 0.66
14 0.64
15 0.65
16 0.69
17 0.71
18 0.71
19 0.72
20 0.81
21 0.85
22 0.9
23 0.91
24 0.87
25 0.82
26 0.78
27 0.69
28 0.62
29 0.59
30 0.51
31 0.46
32 0.44
33 0.44
34 0.4
35 0.4
36 0.4
37 0.35
38 0.38
39 0.39
40 0.36
41 0.35
42 0.38
43 0.42
44 0.47
45 0.52
46 0.54
47 0.55
48 0.57
49 0.61
50 0.66
51 0.66
52 0.68
53 0.68
54 0.71
55 0.74
56 0.79
57 0.79
58 0.8
59 0.77
60 0.7
61 0.61
62 0.51
63 0.41
64 0.33
65 0.23
66 0.15
67 0.12
68 0.1
69 0.1
70 0.1
71 0.1
72 0.11
73 0.19
74 0.26
75 0.33
76 0.38
77 0.44
78 0.47
79 0.51
80 0.55
81 0.57
82 0.6
83 0.61
84 0.61
85 0.59
86 0.6
87 0.59
88 0.53
89 0.46
90 0.39
91 0.36