Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9Z7B8

Protein Details
Accession A0A4Y9Z7B8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-46NTIPIVKKRTKVFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
9-53KKRTKVFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQLPMPKI
Subcellular Location(s) nucl 13, mito_nucl 12.833, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVNTIPIVKKRTKVFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLLPSGLKKLLVSNVREVDLLLMHNKSFAAEVAHNVSSRNRTTILERAKVLGVKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.84
4 0.87
5 0.88
6 0.88
7 0.86
8 0.85
9 0.84
10 0.77
11 0.69
12 0.68
13 0.66
14 0.65
15 0.68
16 0.69
17 0.69
18 0.67
19 0.67
20 0.67
21 0.69
22 0.69
23 0.69
24 0.69
25 0.71
26 0.78
27 0.83
28 0.76
29 0.73
30 0.71
31 0.67
32 0.67
33 0.64
34 0.64
35 0.63
36 0.65
37 0.59
38 0.52
39 0.46
40 0.37
41 0.37
42 0.33
43 0.35
44 0.4
45 0.41
46 0.42
47 0.45
48 0.45
49 0.42
50 0.39
51 0.38
52 0.35
53 0.43
54 0.46
55 0.43
56 0.4
57 0.35
58 0.33
59 0.32
60 0.3
61 0.21
62 0.22
63 0.23
64 0.23
65 0.23
66 0.22
67 0.17
68 0.13
69 0.12
70 0.1
71 0.09
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.07
78 0.09
79 0.09
80 0.11
81 0.15
82 0.16
83 0.16
84 0.17
85 0.19
86 0.21
87 0.22
88 0.22
89 0.2
90 0.2
91 0.25
92 0.33
93 0.37
94 0.37
95 0.37
96 0.37
97 0.38
98 0.37
99 0.33
100 0.3
101 0.24
102 0.21
103 0.24
104 0.28
105 0.27
106 0.27
107 0.31
108 0.28