Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y9YJK3

Protein Details
Accession A0A4Y9YJK3    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
342-379EAFLRCLSTVKQKKDKKRAKKEKSQSKGGRKKKKQRLSBasic
NLS Segment(s)
PositionSequence
62-73ARLPAKRKAPAA
352-379KQKKDKKRAKKEKSQSKGGRKKKKQRLS
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MQNYDEAQKGLERLSIRDNIDPNAARTASLVTIKSLTRSDTSVSWQSNPVLPPPSTQFRKLARLPAKRKAPAARLPRLPDYTQARTSTQAQTLSDSESEDGSGSEDAKSDDELPESGPAEDGDDLDMPSMANMSIRDVSAFEINEFLQTDPYKIVPDPPVEFEQLFVSVSGKAVWQALTLALSSVSYSGKVLKCMSDMTIWTPYEDLSRCVVLYPAQRWNFGTSRAEPAERKTCKAWPRVRETRDMCFSAGGAWHYCGTYQCTGMSIMRLDELCKLDKSKSKTMFNSLVQQTPRVLGGAIQRSSMQTMTSIMQTLRDAYQDGQLLVRCYGFQLVGHNDQVKEAFLRCLSTVKQKKDKKRAKKEKSQSKGGRKKKKQRLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.31
4 0.36
5 0.37
6 0.35
7 0.41
8 0.4
9 0.36
10 0.36
11 0.33
12 0.28
13 0.26
14 0.26
15 0.21
16 0.23
17 0.22
18 0.17
19 0.2
20 0.21
21 0.23
22 0.22
23 0.22
24 0.2
25 0.21
26 0.22
27 0.21
28 0.27
29 0.31
30 0.32
31 0.32
32 0.33
33 0.33
34 0.35
35 0.34
36 0.32
37 0.3
38 0.28
39 0.29
40 0.32
41 0.4
42 0.4
43 0.42
44 0.46
45 0.46
46 0.54
47 0.55
48 0.58
49 0.59
50 0.65
51 0.69
52 0.71
53 0.75
54 0.71
55 0.74
56 0.72
57 0.7
58 0.68
59 0.7
60 0.69
61 0.66
62 0.67
63 0.67
64 0.63
65 0.56
66 0.55
67 0.53
68 0.51
69 0.49
70 0.46
71 0.41
72 0.4
73 0.43
74 0.4
75 0.36
76 0.33
77 0.28
78 0.29
79 0.28
80 0.27
81 0.23
82 0.19
83 0.16
84 0.13
85 0.13
86 0.1
87 0.09
88 0.08
89 0.08
90 0.08
91 0.07
92 0.08
93 0.08
94 0.09
95 0.1
96 0.1
97 0.1
98 0.1
99 0.1
100 0.11
101 0.12
102 0.12
103 0.11
104 0.1
105 0.09
106 0.09
107 0.09
108 0.09
109 0.08
110 0.08
111 0.07
112 0.07
113 0.07
114 0.05
115 0.05
116 0.05
117 0.04
118 0.05
119 0.05
120 0.07
121 0.07
122 0.08
123 0.08
124 0.08
125 0.09
126 0.11
127 0.11
128 0.09
129 0.09
130 0.09
131 0.1
132 0.1
133 0.09
134 0.1
135 0.1
136 0.11
137 0.1
138 0.11
139 0.11
140 0.11
141 0.14
142 0.14
143 0.16
144 0.17
145 0.19
146 0.21
147 0.21
148 0.21
149 0.18
150 0.16
151 0.13
152 0.12
153 0.09
154 0.08
155 0.06
156 0.07
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.05
175 0.09
176 0.1
177 0.12
178 0.12
179 0.12
180 0.13
181 0.13
182 0.14
183 0.1
184 0.1
185 0.11
186 0.15
187 0.15
188 0.14
189 0.14
190 0.13
191 0.15
192 0.15
193 0.14
194 0.11
195 0.11
196 0.11
197 0.11
198 0.11
199 0.11
200 0.14
201 0.16
202 0.23
203 0.23
204 0.24
205 0.25
206 0.29
207 0.27
208 0.27
209 0.27
210 0.21
211 0.26
212 0.26
213 0.28
214 0.24
215 0.29
216 0.35
217 0.33
218 0.34
219 0.31
220 0.36
221 0.41
222 0.5
223 0.52
224 0.5
225 0.58
226 0.65
227 0.66
228 0.69
229 0.65
230 0.62
231 0.6
232 0.53
233 0.44
234 0.34
235 0.31
236 0.23
237 0.21
238 0.15
239 0.11
240 0.1
241 0.1
242 0.1
243 0.11
244 0.11
245 0.13
246 0.13
247 0.13
248 0.12
249 0.13
250 0.14
251 0.14
252 0.15
253 0.11
254 0.1
255 0.11
256 0.11
257 0.11
258 0.14
259 0.15
260 0.16
261 0.17
262 0.19
263 0.22
264 0.28
265 0.35
266 0.4
267 0.46
268 0.51
269 0.53
270 0.58
271 0.6
272 0.57
273 0.59
274 0.52
275 0.5
276 0.43
277 0.41
278 0.35
279 0.29
280 0.27
281 0.18
282 0.15
283 0.12
284 0.18
285 0.24
286 0.24
287 0.23
288 0.24
289 0.24
290 0.26
291 0.23
292 0.16
293 0.1
294 0.12
295 0.12
296 0.13
297 0.13
298 0.12
299 0.13
300 0.14
301 0.15
302 0.14
303 0.14
304 0.14
305 0.14
306 0.18
307 0.18
308 0.18
309 0.18
310 0.19
311 0.2
312 0.19
313 0.19
314 0.14
315 0.13
316 0.15
317 0.12
318 0.11
319 0.15
320 0.2
321 0.24
322 0.28
323 0.3
324 0.29
325 0.3
326 0.3
327 0.25
328 0.22
329 0.2
330 0.19
331 0.17
332 0.19
333 0.18
334 0.22
335 0.24
336 0.33
337 0.4
338 0.46
339 0.56
340 0.63
341 0.74
342 0.81
343 0.88
344 0.89
345 0.91
346 0.93
347 0.93
348 0.95
349 0.95
350 0.95
351 0.93
352 0.93
353 0.92
354 0.92
355 0.92
356 0.91
357 0.92
358 0.92
359 0.94