Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9Y601

Protein Details
Accession A0A4Y9Y601    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
114-191PSPPRELEKEEKRRRKEERRREKEEKRLRKEKKRVERHKHGRSRTPDDKDEDYRSRDRARSRSRSPYRRDKDEGRERGBasic
NLS Segment(s)
PositionSequence
117-191PRELEKEEKRRRKEERRREKEEKRLRKEKKRVERHKHGRSRTPDDKDEDYRSRDRARSRSRSPYRRDKDEGRERG
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019315  MMTA2_N  
IPR039207  MMTAG2-like  
Pfam View protein in Pfam  
PF10159  MMtag  
Amino Acid Sequences MFEPVRGGTRGGQAEFKWADVSADKDRENYLGHSVNAPTGRWQKNKDIHWYNRDLKQSEADRAEEIRKVKEAEAEALAAALGFAGGPKASNSGAPGTGANAIGVAPKPDDAAPPSPPRELEKEEKRRRKEERRREKEEKRLRKEKKRVERHKHGRSRTPDDKDEDYRSRDRARSRSRSPYRRDKDEGRERG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.3
4 0.24
5 0.21
6 0.21
7 0.19
8 0.24
9 0.23
10 0.27
11 0.27
12 0.27
13 0.28
14 0.29
15 0.29
16 0.26
17 0.24
18 0.23
19 0.23
20 0.24
21 0.23
22 0.25
23 0.24
24 0.22
25 0.24
26 0.3
27 0.36
28 0.4
29 0.44
30 0.49
31 0.56
32 0.61
33 0.64
34 0.64
35 0.65
36 0.66
37 0.7
38 0.66
39 0.65
40 0.65
41 0.57
42 0.48
43 0.48
44 0.44
45 0.41
46 0.38
47 0.33
48 0.28
49 0.29
50 0.29
51 0.25
52 0.24
53 0.2
54 0.2
55 0.2
56 0.19
57 0.21
58 0.2
59 0.18
60 0.17
61 0.16
62 0.13
63 0.12
64 0.11
65 0.07
66 0.05
67 0.03
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.03
75 0.04
76 0.05
77 0.05
78 0.06
79 0.07
80 0.07
81 0.08
82 0.08
83 0.07
84 0.08
85 0.07
86 0.06
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.06
95 0.06
96 0.07
97 0.09
98 0.12
99 0.15
100 0.2
101 0.21
102 0.22
103 0.22
104 0.24
105 0.27
106 0.29
107 0.34
108 0.41
109 0.5
110 0.6
111 0.68
112 0.72
113 0.76
114 0.81
115 0.83
116 0.84
117 0.84
118 0.85
119 0.85
120 0.89
121 0.9
122 0.9
123 0.89
124 0.89
125 0.89
126 0.87
127 0.88
128 0.89
129 0.89
130 0.91
131 0.9
132 0.9
133 0.91
134 0.92
135 0.92
136 0.93
137 0.93
138 0.94
139 0.93
140 0.9
141 0.88
142 0.86
143 0.85
144 0.83
145 0.8
146 0.75
147 0.71
148 0.69
149 0.66
150 0.65
151 0.61
152 0.57
153 0.54
154 0.54
155 0.55
156 0.55
157 0.57
158 0.6
159 0.64
160 0.68
161 0.72
162 0.77
163 0.81
164 0.85
165 0.86
166 0.87
167 0.85
168 0.84
169 0.84
170 0.82
171 0.82