Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y9XM26

Protein Details
Accession A0A4Y9XM26    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPEPKDRRRRNTKEKDSESSNGBasic
25-54ASAGDASKKERKRRAPAKRVKEEPSRQQTPHydrophilic
NLS Segment(s)
PositionSequence
31-45SKKERKRRAPAKRVK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPEPKDRRRRNTKEKDSESSNGSVASAGDASKKERKRRAPAKRVKEEPSRQQTPSYGGPGEYTNRQIKGSPHPSSTGSGSASRSVQPSPTGSAPPPPSRVVDEDYDEGVAEALMGLAASGSNAPYRGGPDPRSFGLTSGPGVPRSGPGLSPTMLHHDRRPSMSSRASPPTTGQKRPLSPGPDDRDVEMKRSRVGSISSAGNGNGRRVSPQSGSGGRPSPVPSRLSPIPFRQQPTSHSPEARQAEARSYPPSPAPALPTCSRRTRARSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.88
3 0.83
4 0.77
5 0.7
6 0.61
7 0.5
8 0.39
9 0.31
10 0.24
11 0.17
12 0.14
13 0.11
14 0.09
15 0.11
16 0.12
17 0.18
18 0.26
19 0.34
20 0.42
21 0.51
22 0.6
23 0.69
24 0.78
25 0.84
26 0.87
27 0.9
28 0.91
29 0.92
30 0.89
31 0.86
32 0.85
33 0.83
34 0.82
35 0.81
36 0.76
37 0.67
38 0.63
39 0.57
40 0.52
41 0.47
42 0.4
43 0.31
44 0.26
45 0.25
46 0.25
47 0.26
48 0.23
49 0.25
50 0.25
51 0.26
52 0.26
53 0.28
54 0.29
55 0.37
56 0.43
57 0.41
58 0.38
59 0.39
60 0.4
61 0.4
62 0.38
63 0.3
64 0.23
65 0.22
66 0.21
67 0.2
68 0.2
69 0.19
70 0.19
71 0.17
72 0.16
73 0.16
74 0.16
75 0.17
76 0.18
77 0.18
78 0.17
79 0.23
80 0.27
81 0.28
82 0.3
83 0.28
84 0.28
85 0.28
86 0.3
87 0.26
88 0.23
89 0.23
90 0.21
91 0.2
92 0.18
93 0.15
94 0.13
95 0.1
96 0.07
97 0.04
98 0.03
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.03
108 0.03
109 0.04
110 0.04
111 0.05
112 0.07
113 0.1
114 0.13
115 0.16
116 0.18
117 0.2
118 0.2
119 0.23
120 0.21
121 0.19
122 0.17
123 0.15
124 0.13
125 0.14
126 0.14
127 0.12
128 0.12
129 0.11
130 0.1
131 0.12
132 0.12
133 0.08
134 0.09
135 0.11
136 0.11
137 0.12
138 0.12
139 0.17
140 0.19
141 0.21
142 0.22
143 0.25
144 0.27
145 0.29
146 0.31
147 0.28
148 0.31
149 0.34
150 0.34
151 0.35
152 0.39
153 0.37
154 0.35
155 0.34
156 0.39
157 0.41
158 0.41
159 0.43
160 0.43
161 0.44
162 0.48
163 0.51
164 0.44
165 0.43
166 0.48
167 0.47
168 0.46
169 0.45
170 0.41
171 0.43
172 0.4
173 0.4
174 0.36
175 0.31
176 0.28
177 0.28
178 0.28
179 0.22
180 0.23
181 0.2
182 0.2
183 0.2
184 0.18
185 0.18
186 0.17
187 0.19
188 0.18
189 0.18
190 0.17
191 0.16
192 0.17
193 0.19
194 0.23
195 0.21
196 0.23
197 0.27
198 0.28
199 0.3
200 0.32
201 0.32
202 0.29
203 0.29
204 0.3
205 0.29
206 0.3
207 0.32
208 0.29
209 0.33
210 0.38
211 0.41
212 0.43
213 0.45
214 0.5
215 0.52
216 0.56
217 0.55
218 0.53
219 0.53
220 0.56
221 0.56
222 0.52
223 0.5
224 0.47
225 0.5
226 0.51
227 0.49
228 0.45
229 0.4
230 0.4
231 0.41
232 0.41
233 0.37
234 0.34
235 0.33
236 0.31
237 0.33
238 0.3
239 0.28
240 0.32
241 0.31
242 0.36
243 0.39
244 0.43
245 0.45
246 0.5
247 0.54
248 0.56